KEGG   Escherichia coli KO11FL: EKO11_0973
Entry
EKO11_0973        CDS       T01718                                 

Definition
(GenBank) Conserved hypothetical protein CHP00730
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00240  Pyrimidine metabolism
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_0973
   00240 Pyrimidine metabolism
    EKO11_0973
Enzymes [BR:eko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     EKO11_0973
    3.2.2.-  
     EKO11_0973
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: ADX49609
Structure
PDB: 
6GFL 6GFM

Position
complement(1024947..1026311)
AA seq 454 aa
MITHISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSLTDNSKELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDILFVYGQIHNTVRFPNL
NLDNSVHITNLVFSILRNARALHVGEAPNMVVCWGGHSINENEYLYARRVGNQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELIIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQVLPLILTGPKESADYFRVLD
EFVVHTLGENARRHYRIIIDDAAEVARQMKKSMPLVKENRRDTGDAYSFNWSMRIAPDLQ
MPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGNVKEVGIRAIEEFGPYKINGDK
EIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEICT
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacatattagcccgcttggctccatggatatgttgtcgcagctggaagtggat
atgcttaaacgcaccgccagcagcgacctctatcaactgtttcgcaactgttcacttgcc
gtactgaactccggtagtttgaccgataacagcaaagaattgctgtctcgttttgaaaat
ttcgatattaacgtcctgcgccgtgaacgcggcgtaaagctggaactgattaatcccccg
gaagaggcttttgtcgatgggcgaattattcgcgctttgcaggccaacttgttcgcggtt
ctgcgagacattctcttcgtttacgggcaaatccataataccgttcgttttcccaacctg
aatctcgacaactccgtccacatcactaacctggtcttttccatcttgcgtaacgctcgc
gcgctgcatgtgggtgaagcgccaaatatggtggtctgctggggcggtcactcaattaac
gaaaatgagtatttgtatgcccgtcgcgtcggaaaccagctgggcctgcgtgagctgaat
atctgcaccggctgtggtccgggagcgatggaagcgccgatgaaaggtgctgcggtcgga
cacgcgcagcagcgttacaaagacagtcgttttattggtatgacagagccgtcgattatc
gccgctgaaccgcctaacccgctggtcaacgaattgatcatcatgccggatatcgaaaaa
cgtctggaagcgtttgtccgtatcgctcacggcatcattatcttccctggcggtgtgggt
acggcagaagagttgctgtatttgctgggaattttaatgaacccggccaacaaagatcag
gttttaccattgatcctcaccggcccgaaagagagcgccgactacttccgcgtactggac
gagtttgtcgtacatacgctgggcgaaaacgcgcgccgccattaccgcatcatcattgat
gacgccgctgaagtcgctcgtcagatgaaaaaatcgatgccgctggtgaaagaaaatcgc
cgtgatacaggcgatgcctacagctttaactggtcaatgcgcattgcgccagatttgcaa
atgccgtttgagccgtctcacgagaatatggctaatctgaagctttacccggatcaacct
gttgaagtgctggctgccgacctgcgccgtgcgttctccggtattgtggcgggtaacgta
aaagaagtcggtattcgcgccattgaagagtttggtccttacaaaatcaacggcgataaa
gagattatgcgtcgtatggacgacctgctacagggttttgttgcccagcatcgtatgaag
ttgccaggctcagcctacatcccttgctacgaaatctgcacgtaa

DBGET integrated database retrieval system