KEGG   Escherichia coli KO11FL: EKO11_0974
Entry
EKO11_0974        CDS       T01718                                 

Definition
(GenBank) 7-cyano-7-deazaguanine reductase
  KO
K06879  7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00790  Folate biosynthesis
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EKO11_0974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eko03016]
    EKO11_0974
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     EKO11_0974
Transfer RNA biogenesis [BR:eko03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EKO11_0974
SSDB
Motif
Pfam: QueF_N QueF
Other DBs
NCBI-ProteinID: ADX49610
Position
complement(1026423..1027271)
AA seq 282 aa
MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFHGTDIWTLY
ELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLS
TCAQGKVSVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFTTDYLENATCGEKVVEET
LVSHLLKSNCLITHQPDWGSIQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDL
LRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtcttcttatgcaaaccatcaggcacttgcgggcctgactcttggaaaatcaaccgat
taccgggatacctatgacgctagcctactgcaaggcgttccacgcagcctgaatcgcgac
ccgctgggtctgaaagcggataacctgccttttcacggtacggatatctggacgctgtat
gaactttcctggctgaatgcgaaaggtttgccgcaggtcgctgtcggtcatgttgaactt
gattacaccagcgtaaatctgattgagtcgaagagttttaagctctatctcaacagtttt
aaccagacgcgttttaataactgggatgaggtgcgccagacgctggagcgcgacttaagc
acttgcgcccagggtaaggttagcgtggcgttatatcgtcttgatgaactggaaggccag
ccgataggtcattttaatggcacttgcattgatgaccaggatatcactatcgataactat
gaattcactactgactatctggagaatgccacctgtggtgaaaaagtagtggaagagacg
cttgtcagccacctgctgaaatcaaactgcctgatcacccatcaaccagattggggttcg
atccaaattcagtatcgtggacgccaaattgacagagaaaaactgctgcgttacctggtc
tcattccgtcatcacaacgagttccacgaacagtgcgtggaacgcatctttaatgacctg
ttacgcttctgccagccagaaaaattgagcgtttacgcacgttatacccgtcgtggcggt
ctggacattaacccgtggcgcagtaatagcgattttgtcccatcgaccacaagactggtt
cggcaataa

DBGET integrated database retrieval system