KEGG   Escherichia coli KO11FL: EKO11_0978
Entry
EKO11_0978        CDS       T01718                                 

Definition
(GenBank) flavodoxin/nitric oxide synthase
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: Flavodoxin_1
Other DBs
NCBI-ProteinID: ADX49614
Structure
PDB: 
2M6R 2M6S

Position
1029635..1030084
AA seq 149 aa
MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTG
QGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNFCNGGKQFDALLQEQSAQRVG
EMLLIDASENPEPETESNPWVEQWGTLLS
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcggaaattggtatttttgtcggcaccatgtacggaaattcgctgttagtggcggaa
gaagcagaagcaattctgaccgcacagggccacaaagcaacggtatttgaagatcctgaa
ttaagcgactggctgccctatcaggataagtatgttctggtggttacgtccacgaccggg
cagggcgaccttcctgatagcattgtgccgctctttcagggaatcaaagatagtctgggc
ttccagccgaatctgcgttatggcgtgattgcgctcggcgacagcagttatgtaaatttc
tgcaatggcggcaaacagttcgatgccttgttgcaggaacagagcgctcagcgggttggc
gaaatgctgttgattgacgccagtgagaacccggaaccggaaacggaatcaaatccgtgg
gtcgaacagtggggcacgctgttgtcctga

DBGET integrated database retrieval system