KEGG   Escherichia coli KO11FL: EKO11_0979
Entry
EKO11_0979        CDS       T01718                                 

Definition
(GenBank) d-galactonate transporter
  KO
K03535  MFS transporter, ACS family, glucarate transporter
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eko02000]
    EKO11_0979
Transporters [BR:eko02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    EKO11_0979
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-ProteinID: ADX49615
Position
1030519..1031871
AA seq 450 aa
MSSLSQAASSVEKRTNARYWIVVMLFIVTSFNYGDRATLSIAGSEMAKDIGLDPVGMGYV
FSAFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSMFTLLQGFVDIFSGFGIIVALFTL
RFLVGLAEAPSFPGNSRIVAAWFPAQERGTAVSIFNSAQYFATVIFAPIMGWLTHEVGWS
HVFFFMGGLGIVISFIWLKVIHEPNQHPGVNQKELEYIAAGGALINMDQQNTKVKVPFSV
KWGQIKQLLGSRMMIGVYIGQYCINALTYFFITWFPVYLVQARGMSILKAGFVASVPAVC
GFIGGVLGGIISDWLMRRTGSLNIARKTPIVMGMLLSMVMVFCNYVNVEWMIIGFMALAF
FGKGIGALGWAVMADTAPKEISGLSGGLFNMFGNISGIVTPIAIGYIVGTTGSFNGALIY
VGVHALIAVLSYLVLVGDIKRIELKPVAGQ
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagttctttaagtcaggctgcgagcagtgtggaaaaacgcacgaatgctcgttactgg
atagtggtgatgttgtttatcgtcacatccttcaactacggcgaccgcgctacgctttct
attgccggttcggaaatggccaaagatatcggccttgatcccgtgggaatgggctatgtg
ttctctgccttctcatgggcttatgttatcgggcagatccctggtggttggttgctggat
cgttttggttcaaaacgcgtctacttctggtcgatctttatctggtcgatgtttaccttg
ctgcaaggcttcgtcgatatctttagtggattcggcattatcgttgccctgtttactctg
cgcttcctggtcgggcttgctgaagcgccatctttccccggcaacagtcgcattgttgcg
gcctggtttccggcgcaggaaaggggaacggcggtgtcgatttttaactccgctcaatac
ttcgcaacggtgatcttcgcgccgattatgggctggctgacgcatgaagtgggctggtca
cacgtcttcttctttatgggcggtctggggattgtcatcagctttatctggttgaaagtc
atccacgagccaaatcaacatccgggggtaaatcagaaagagctggagtacatcgccgcg
ggtggcgcgctgatcaatatggatcagcaaaacaccaaagttaaagtgccgttcagcgtg
aagtgggggcagatcaaacagctgctcgggtcacggatgatgatcggcgtttatatcggt
cagtactgtatcaacgccctgacttacttctttattacctggttcccggtttatctggtg
caggcacgcgggatgtcgattctgaaagcgggctttgtggcttccgttccggcggtttgc
ggttttatcggcggtgtgctgggtgggattatttccgactggctgatgcgccgcacggga
tcgctgaacattgcgcgtaaaacaccgatcgtaatgggcatgttgctgtcgatggtgatg
gtgttctgcaactacgtcaacgttgagtggatgatcatcggctttatggcgctggccttc
ttcggtaagggcatcggggcgctgggttgggcagtaatggcagataccgcgccaaaagag
atcagcggtctttccggtggcctgttcaacatgttcggtaacatttctggcatcgtcacg
ccaatcgcaattggttatatcgttggcacgactggctcctttaatggggcgctgatttat
gttggtgttcatgccttaatcgcggtactgagctacctggtgctggtgggcgatatcaag
cgtatcgagctgaaacctgtcgcggggcaataa

DBGET integrated database retrieval system