KEGG   Escherichia coli KO11FL: EKO11_0980
Entry
EKO11_0980        CDS       T01718                                 

Definition
(GenBank) Mandelate racemase/muconate lactonizing protein
  KO
K13918  glucarate dehydratase-related protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    EKO11_0980
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N TcfC
Other DBs
NCBI-ProteinID: ADX49616
Structure
PDB: 
4GYP 4IL0

Position
1031873..1033213
AA seq 446 aa
MTTQSSPVITDMKVIPVAGHDSMLLNIGGAHSAYFTRNIVVLTDNAGHTGIGEAPGGEVI
YQTLVDAIPMVLGQEVARLNKVVQQVHIGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGKALNVPVCELLGPGKQRDAITVLGYLFYIGDRTKTDLPYLENTPGNHEWYQLRHQK
AMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTKNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgacgacacaatccagtcctgttattactgatatgaaagtcattccggtcgccgggcac
gatagcatgttgcttaatattggtggtgcacatagcgcatatttcacccgcaatattgtg
gtactcaccgataatgccgggcataccggtattggtgaagcgccgggcggagaggtgatt
tatcagacgcttgtcgatgctattccgatggtgctgggccaggaagttgcgcgcctgaat
aaagtggttcagcaggtgcatataggtaatcaggcggccgattttgataccttcggcaaa
ggtgcctggacttttgaattgcgcgttaatgccgtggcggcgctggaagccgccttgctt
gacctgctaggtaaggcgttgaatgttccggtctgcgaactgttagggccaggcaagcaa
cgcgatgctattaccgtcctcggttatctgttttatatcggtgatcggaccaaaaccgat
cttccttatctggaaaatacgccgggcaaccatgagtggtatcagttgcgccatcagaaa
gcgatgaacagcgaagccgttgtgcgtctggcggaagcctcacaggatcgctatggcttt
aaagatttcaaacttaagggcggagtgttacctggcgagcaagaaatcgacactgttcgt
gcattgaagaaacgcttcccggatgcgcggattaccgttgatcccaacggtgcatggctg
cttgatgaagccatttctttgtgcaaagggctgaatgatgttcttacctatgccgaagat
ccgtgcggcgctgagcagggtttctccggtcgtgaagtgatggcggagtttcgacgggcg
accggcttgcccgtcgcgactaacatgatcgccaccaactggcgcgaaatgggccatgcg
gtgatgctcaatgcggtagatattccacttgccgatccgcacttctggacgctttccggt
gcagtccgcgtggcacagctttgcgacgactgggggctaacctggggctgccattctaat
aaccatttcgatatttctctggcgatgtttacccatgtgggcgcggcggcaccgggtaat
cctaccgctatcgatacccactggatttggcaggagggcgattgtcgcctgaccaaaaat
ccgctggagattaaaaacggaaaaattgccgttcctgatgcgcccggtctgggcgtggaa
ctggactgggaacaggtacaaaaggcacatgaggcctataaacgtctgcctggcggtgcg
cgtaacgacgcaggtccgatgcagtacctgatccccggctggacctttgaccgtaaacgt
cccgttttcggccgtcactga

DBGET integrated database retrieval system