KEGG   Escherichia coli KO11FL: EKO11_0981
Entry
EKO11_0981        CDS       T01718                                 

Definition
(GenBank) glucarate dehydratase
  KO
K01706  glucarate dehydratase [EC:4.2.1.40]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00053  Ascorbate and aldarate metabolism
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    EKO11_0981
Enzymes [BR:eko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.40  glucarate dehydratase
     EKO11_0981
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N Radical_SAM
Other DBs
NCBI-ProteinID: ADX49617
Structure
PDB: 

Position
1033234..1034574
AA seq 446 aa
MSSQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGRTLGEYKNVLTLVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGDRKATPLPYQSQPDDSCDWYRLRHE
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAW
SLNEAIKIGKYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPFEIKGGLVQVPEKPGLGVEIDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagttctcaatttacgacgcctgttgttactgaaatgcaggtcatcccggtggcgggt
catgacagtatgctgatgaatctgagtggtgcacacgcaccgttcttcacgcgtaatatt
gtgattatcaaagataattccggtcacaccggcgtaggcgaaattcccggcggcgagaaa
atccgtaaaacgctggaagatgcgattccgctggtggtgggtagaacgctgggtgaatac
aaaaacgttctgacgctggtgcgtaatacatttgccgatcgtgatgccggcgggcgcggt
ttgcagacatttgatttgcgtaccactattcatgtagttaccgggatagaagcggcaatg
ctggatctgctggggcagcatctgggggtaaacgtggcatcgctgctgggcgatggtcaa
cagcgtagcgaagtcgaaatgctcggttatctgttcttcgtcggtgatcgcaaagccaca
ccgctgccgtatcaaagccagccggatgactcatgcgactggtatcgcctgcgtcatgaa
gaagcgatgacgccggatgcggtggtgcgcctggcggaagcggcgtatgaaaaatatggc
ttcaacgatttcaaactgaaaggcggtgtactggccggggaagaagaggccgagtctatt
gtggcactggcgcaacgcttcccgcaggcgcgtattacgctcgatcctaacggtgcctgg
tcgctgaacgaagcgattaaaattggtaaatacctgaaagggtcgctggcttatgcagaa
gatccgtgtggtgcggagcaaggtttctccgggcgtgaagtgatggcagagttccgtcgc
gcaactggcctgccgaccgcaaccaatatgatcgccaccgactggcggcagatgggccat
acgctctccctgcaatccgttgatatcccgctggcggatccgcatttctggacgatgcaa
ggttcggtacgtgtggcgcaaatgtgccatgaatttggcctgacctggggttcacactca
aacaaccacttcgatatttccctggcgatgtttacccatgttgccgccgctgcaccgggt
aaaattactgctattgatacgcactggatctggcaggaaggtaatcagcgcctgaccaaa
gaaccgtttgagatcaaaggcggtctggttcaggtgccggaaaaaccggggctgggtgta
gaaatcgatatggatcaagtgatgaaagcccatgagctgtatcagaaacacgggcttggc
gcgcgtgacgatgcgatgggaatgcagtatctgattcctggctggacgttcgataacaag
cgcccgtgcatggtgcgttaa

DBGET integrated database retrieval system