KEGG   Escherichia coli KO11FL: EKO11_0983
Entry
EKO11_0983        CDS       T01718                                 

Definition
(GenBank) RNA methyltransferase, TrmA family
  KO
K03215  23S rRNA (uracil1939-C5)-methyltransferase [EC:2.1.1.190]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eko03009]
    EKO11_0983
Enzymes [BR:eko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.190  23S rRNA (uracil1939-C5)-methyltransferase
     EKO11_0983
Ribosome biogenesis [BR:eko03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EKO11_0983
SSDB
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_31 TRAM Methyltransf_25 PCMT RrnaAD Met_10 Methyltransf_11 MTS Cons_hypoth95 UPF0020 Methyltransf_23 Methyltransf_15 Methyltr_RsmB-F Methyltransf_4 Ubie_methyltran PrmA Methyltrans_SAM MetW CMAS
Other DBs
NCBI-ProteinID: ADX49618
Structure
PDB: 
1UWV 2BH2

Position
1037619..1038920
AA seq 433 aa
MAQFYSAKRRTTTRQIITVSVNDLDSFGQGVARHNGKALFIPGLLPQENAEVTVTEDKKQ
YARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKHEVSEVI
ADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPILVPQLEALLPKVRACL
GSLQAIRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDSEILE
TVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNF
TLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKV
LLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLDMFPHT
GHLESMVLFSRVK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgcaattctactctgcaaaacgacgcacgacgacgcgtcagatcataaccgtttca
gtcaacgacctcgactcttttggtcagggcgtggcgcgacataacggcaaagcgttattt
attcctggattactgccacaggaaaacgcggaagttactgttactgaagataaaaaacag
tacgcccgcgctaaagtcgtgcgccggttaagcgatagcccggaacgcgaaacgccacgc
tgccctcattttggcgtatgcggtggctgtcagcaacaacacgccagcgtggatttacag
cagcgaagcaaaagtgcggcactcgcccgattaatgaaacacgaagtctctgaagtgatc
gccgatgttccctggggctatcgccgtcgcgcgcgtttaagtttgaactacttaccgaaa
acacagcaacttcagatgggctttcgcaaagcgggctccagtgacattgtcgacgtcaaa
caatgccccattttagtgccccaacttgaagcattgctgcccaaagtcagggcatgcctg
ggcagcttacaagctatacgccatcttggtcatgttgaactggtacaggcaaccagcggc
acgctgatgattttgcgccataccgcaccgctaagttcggctgatcgcgaaaaactggaa
cgcttttcgcattctgaaggcctggatctgtatctcgcccccgatagtgagatactcgaa
accgtctctggtgagatgccctggtatgactcaaacgggttgcgcttaacttttagcccg
cgcgattttattcaggtcaatgcgggtgtgaaccaaaaaatggtagcgcgtgcgttggaa
tggctggatgtgcaacctgaagatcgcgtactggatctgttctgcggtatgggcaacttt
acactgccattggcgacacaagctgccagtgtggtgggtgtagaaggtgttccggcgctg
gtggaaaaaggccagcagaatgcgcgtcttaatggcttacagaatgtgacgttttatcac
gaaaatcttgaagaagatgtcacaaagcagccgtgggcgaaaaacggcttcgataaagtg
ttgctggaccccgcgcgagcaggtgccgcaggtgttatgcagcaaattataaaactggaa
cctattcgtatagtttatgtatcctgtaatcctgcaacgctggctcgggatagcgaagcg
ttattaaaagcaggatataccattgcgcgactggcgatgctggatatgttcccacacacg
ggacatctggaatcgatggtacttttctcgcgcgttaaatag

DBGET integrated database retrieval system