KEGG   Escherichia coli KO11FL: EKO11_0984
Entry
EKO11_0984        CDS       T01718                                 

Definition
(GenBank) (p)ppGpp synthetase I, SpoT/RelA
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_0984
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     EKO11_0984
SSDB
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 ACT Prok-JAB AAA_26
Other DBs
NCBI-ProteinID: ADX49619
Position
1038968..1041202
AA seq 744 aa
MVAVRSAHINKAGEFDPEKWIASLGITSQKSCECLAETWAYCLQQTQGHPDASLLLWRGV
EMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLK
ATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECTN
IYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERRLDREHYIEEFVGHLRAEM
KAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRIVAERLQDCYAALGIVHTHY
RHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRTKQMHEDAELGVAAHWKYKEG
AAAGGARSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRSQVFDDRVYVFTPKGDVVDLPA
GSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPNL
GYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELEHLGISLKEAEKHLLPRYNFNDVD
ELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAALKQLQQKSYTPQNRSKDNGRVVVE
GVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHRADCEQLAELRSHAPERIVDAVWGES
YSAGYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQ
VLGRVLGKLNQVPDVIDARRLHGS
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggttgcggtaagaagtgcacatatcaataaggctggtgaatttgatccggaaaaatgg
atcgcaagtctgggtattaccagccagaagtcgtgtgagtgcttagccgaaacctgggcg
tattgtctgcaacagacgcaggggcatccggatgccagtctgttattgtggcgtggtgtt
gagatggtggagatcctctcgacattaagtatggacattgacacgctgcgggcggcgctg
ctgttccctctggctgatgccaacgtagttagcgaagatgtgctgcgtgagagcgtcggt
aagtcggttgttaaccttattcacggcgtgcgtgatatggcggcgatccgccagctgaaa
gcgacgcacactgattctgtttcctccgaacaggtcgataacgttcgccggatgttattg
gcgatggtcgatgattttcgctgcgtggtcatcaaactggcggagcgtattgctcatctg
cgcgaagtaaaagatgcgccggaagatgaacgcgtactggcggcaaaagagtgcaccaat
atctacgcgccgttggcgaaccgtcttgggattgggcaactgaaatgggagctggaagat
tactgcttccgttatctgcacccgaccgaatacaaacgcatcgcaaaactgctgcatgaa
cgccgtctcgaccgcgaacactatatcgaagagtttgtcggtcatctgcgcgctgagatg
aaagctgaaggcgttaaagctgaagtgtatggtcgtccgaaacacatctacagcatctgg
cgtaaaatgcagaaaaagaacctcgcctttgatgagctgtttgatgtgcgtgcggtacgt
attgtcgccgagcgtttacaggattgctatgccgcactggggatagtgcacactcactat
cgccacctgccggatgagtttgacgattatgtcgctaacccgaaaccaaacggttatcag
tctattcataccgtggttctggggccaggtggcaaaaccgttgagatccaaatccgcacc
aaacagatgcatgaagatgcagagttgggtgttgctgcgcactggaaatataaagagggc
gcggcagctggcggcgcacgttcgggacatgaagaccggattgcctggctgcgtaaactg
attgcgtggcaggaagagatggctgattccggcgaaatgctcgacgaagtacgcagccag
gtctttgacgaccgggtgtatgtctttacgccgaaaggtgatgtcgttgatttgcctgcg
ggatcaacgccgctggacttcgcttaccacatccacagtgatgtcggacaccgctgcatc
ggggcaaaaattggcgggcgcattgtgccgttcacctaccagctgcagatgggcgaccag
attgaaattatcacccagaaacagccgaaccccagccgtgactggttaaacccaaacctc
ggttacgtcacaaccagccgtgggcgttcgaaaattcacgcctggttccgtaaacaggac
cgtgacaaaaacattctggctgggcggcaaatccttgacgacgagctggaacatctgggg
atcagcctgaaagaagcagaaaaacatctgctgccgcgttacaactttaatgatgtcgac
gagttgctggcggcgattggtggcggggatatccgtctcaatcagatggtgaacttcctg
caatcgcaatttaataagccgagtgccgaagagcaggacgccgccgcgctgaagcaactt
cagcaaaaaagctacacgccgcaaaaccgcagtaaagataacggtcgcgtggtggttgaa
ggtgtcggtaacctgatgcaccacatcgcgcgctgctgccagccgattcctggagatgag
attgtcggcttcattacccaggggcgcggtatttcagtacaccgcgccgattgcgaacaa
ctggcggaactgcgctcccatgcgccagaacgcattgttgacgcggtatggggtgagagc
tactccgccggatattcgctggtggtccgcgtggtggctaatgatcgtagtgggttgtta
cgtgatatcacgaccattctcgccaacgagaaggtgaacgtgcttggcgttgccagccgt
agcgacaccaaacagcaactggcgaccatcgacatgaccattgagatttacaacctgcaa
gtgctggggcgcgtgctgggtaaactcaaccaggtgccggatgttatcgacgcgcgtcgg
ttgcacgggagttag

DBGET integrated database retrieval system