KEGG   Escherichia coli KO11FL: EKO11_0986
Entry
EKO11_0986        CDS       T01718                                 

Definition
(GenBank) transcriptional modulator of MazE/toxin, MazF
  KO
K07171  mRNA interferase MazF [EC:3.1.-.-]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_0986
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EKO11_0986
Prokaryotic defense system [BR:eko02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    EKO11_0986
SSDB
Motif
Pfam: PemK_toxin
Other DBs
NCBI-ProteinID: ADX49621
Structure
PDB: 

Position
1041528..1041863
AA seq 111 aa
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPF
EVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
NT seq 336 nt   +upstreamnt  +downstreamnt
atggtaagccgatacgtacccgatatgggcgatctgatttgggttgattttgacccgaca
aaaggtagcgagcaagctggacatcgtccagctgttgtcctgagtcctttcatgtacaac
aacaaaacaggtatgtgtctgtgtgttccttgtacaacgcaatcaaaaggatatccgttc
gaagttgttttatccggtcaggaacgtgatggcgtagcgttagctgatcaggtaaaaagt
atcgcctggcgggcaagaggagcaacgaagaaaggaacagttgccccagaggaattacaa
ctcattaaagccaaaattaacgtactgattgggtag

DBGET integrated database retrieval system