KEGG   Escherichia coli KO11FL: EKO11_0987
Entry
EKO11_0987        CDS       T01718                                 

Definition
(GenBank) MazG family protein
  KO
K04765  nucleoside triphosphate diphosphatase [EC:3.6.1.9]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00240  Pyrimidine metabolism
eko00760  Nicotinate and nicotinamide metabolism
eko00770  Pantothenate and CoA biosynthesis
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_0987
   00240 Pyrimidine metabolism
    EKO11_0987
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EKO11_0987
   00770 Pantothenate and CoA biosynthesis
    EKO11_0987
Enzymes [BR:eko01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     EKO11_0987
SSDB
Motif
Pfam: MazG PRA-PH MazG-like Ofd1_CTDD DUF3168 Gluconate_2-dh3
Other DBs
NCBI-ProteinID: ADX49622
Structure
PDB: 
3CRA 3CRC

Position
1041934..1042725
AA seq 263 aa
MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELG
DLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKT
EERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEA
RQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLE
MTGVDLETMEEVWQQVKRQEIDL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaatcaaatcgaccgtttgctcactattatgcagcgcctgcgcgatccggaaaacggc
tgcccgtgggataaagagcagacatttgccaccattgcgccttacacccttgaagaaacc
tacgaagtgctggacgccatcgcccgtgaagattttgacgatcttcgcggtgaactgggc
gatctgctattccaggtggtgttttacgcgcaaatggctcaggaagaagggcgctttgac
tttaatgatatttgcgctgctattagcgataaattagagcgtcgccatccgcatgttttt
gctgatagttctgccgaaaacagtagtgaagtgcttgcccgttgggagcaaatcaaaacc
gaagagcgcgcgcagaaagcgcagcattcggcgctggacgatattcctcgtagtttaccg
gctttaatgcgtgcgcaaaaaatccagaaacgttgcgccaacgttggcttcgattggacg
acgcttggtccggtagtcgataaagtctacgaagagatcgacgaggtgatgtacgaagcg
cggcaggctgttgtcgaccaggctaaactggaggaggaaatgggggacctgctgtttgcc
acggtcaatctggctcgtcatttagggacaaaagcggaaatcgcattgcaaaaagcgaac
gaaaaatttgagcgtcgttttcgcgaagtggagcgtattgttgccgcgcgtggactggaa
atgacaggtgttgacctcgaaacaatggaagaagtctggcaacaggtaaaacggcaggaa
attgatctctaa

DBGET integrated database retrieval system