KEGG   Escherichia coli KO11FL: EKO11_0988
Entry
EKO11_0988        CDS       T01718                                 

Definition
(GenBank) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00240  Pyrimidine metabolism
eko01100  Metabolic pathways
Module
eko_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EKO11_0988
Enzymes [BR:eko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     EKO11_0988
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-ProteinID: ADX49623
Structure
PDB: 

Position
1042953..1044590
AA seq 545 aa
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEV
FVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHIT
NAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYM
AASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKD
VDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIE
LPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEG
MITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWR
DENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQ
IEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQ
KRQAK
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgacaacgaactatatttttgtgaccggcggggtcgtatcctctctgggtaaaggcatt
gccgcagcctccctcgcagccattcttgaagcccgtggcctcaatgtgaccatcatgaaa
ctggatccttacatcaacgtcgatccaggtactatgagcccaatccaacacggggaagtg
ttcgttactgaagacggcgctgaaaccgacctggacctggggcactacgagcgtttcatt
cgtaccaaaatgagccgccgcaacaacttcaccacgggtcgtatctactctgacgttctg
cgtaaagaacgccgcggtgactacctcggcgcaaccgtgcaggttattccgcacatcact
aacgcaatcaaagagcgcgtgctggaaggtggcgaaggtcatgacgtagtactggtagaa
atcggcggtacagtaggtgatatcgaatccttgccgttcctcgaagcgattcgccagatg
gctgttgaaattggccgtgagcacactctgtttatgcacctgacgctggtgccgtacatg
gcagcgtctggtgaagtcaaaaccaaaccgactcagcactctgtaaaagagctgctctcc
atcggtatccagcctgacatcctgatttgtcgttcagatcgcgctgttccggcgaacgaa
cgtgcgaagattgcattgttctgtaatgttccggaaaaagcggttatttctctgaaagac
gtcgattccatctataaaattccgggcctgttgaaatctcaggggctggacgattatatt
tgtaaacgattcagcttaaactgcccggaagcgaatctgtccgaatgggaacaggttatc
ttcgaagaagcgaacccggtaagtgaagtcaccatcggtatggtcggcaagtacattgaa
ctgccggatgcttataaatcagtgatcgaagcactgaaacacggtgggctgaagaatcgt
gtcagcgtcaacatcaaactgatcgattcacaagatgttgaaacgcgcggcgttgaaatc
cttaaaggtctggacgcaatcctcgtacctggcggtttcggctatcgtggcgtagaaggc
atgattacgaccgcgcgttttgcgcgtgagaacaatattccttatctgggcatttgcctg
ggtatgcaggtggcgttaattgattacgctcgccatgttgccaacatggagaacgccaac
tctacggaatttgtgccagactgtaagtacccggttgtggcgctgattaccgagtggcgc
gatgaaaacggcaacgttgaagttcgtagcgagaagagcgatctcggcggtaccatgcgt
ctcggcgcacagcagtgccagttggttgacgatagcctggttcgccagctgtacaatgcg
ccgacaattgttgagcgtcatcgtcaccgttacgaagtcaacaacatgctgttgaaacag
attgaagatgcaggtctgcgcgttgcgggccgttccggggatgatcagttggtcgagatc
atcgaagttccgaatcacccgtggttcgtggcttgccagttccatccggagtttacttct
actccacgtgatggtcacccgctgtttgcaggctttgtgaaagccgccagcgagttccag
aaacgtcaggcgaagtaa

DBGET integrated database retrieval system