KEGG   Escherichia coli KO11FL: EKO11_0989
Entry
EKO11_0989        CDS       T01718                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00010  Glycolysis / Gluconeogenesis
eko00680  Methane metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01200  Carbon metabolism
eko01230  Biosynthesis of amino acids
eko03018  RNA degradation
Module
eko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eko_M00002  Glycolysis, core module involving three-carbon compounds
eko_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EKO11_0989
  09102 Energy metabolism
   00680 Methane metabolism
    EKO11_0989
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EKO11_0989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eko03019]
    EKO11_0989
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eko04147]
    EKO11_0989
Enzymes [BR:eko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     EKO11_0989
Messenger RNA biogenesis [BR:eko03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EKO11_0989
Exosome [BR:eko04147]
 Exosomal proteins
  Proteins found in most exosomes
   EKO11_0989
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-ProteinID: ADX49624
Structure
PDB: 

Position
1044678..1045976
AA seq 432 aa
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtccaaaatcgtaaaaatcatcggtcgtgaaatcatcgactcccgtggtaacccgact
gttgaagccgaagtacatctggagggtggtttcgtcggtatggcagctgctccgtcaggt
gcttctactggttcccgtgaagctctggaactgcgcgatggcgacaaatcccgtttcctg
ggtaaaggcgtaaccaaagctgttgctgcggtaaacggcccgatcgctcaggcgctgatt
ggcaaagatgctaaagatcaggctggcattgacaagatcatgatcgacctggacggcacc
gaaaacaaatccaaattcggcgcgaacgcaatcctggctgtatctctggctaacgccaaa
gctgctgcagctgctaaaggtatgccgctgtacgagcacatcgctgaactgaacggtact
ccgggcaaatactctatgccggttccgatgatgaacatcatcaacggtggtgagcacgct
gacaacaacgttgatatccaggaattcatgattcagccggttggcgcgaaaactgtgaaa
gaagccatccgcatgggttctgaagttttccatcacctggcaaaagttctgaaagcgaaa
ggcatgaacactgctgttggtgacgaaggtggctatgcgccgaacctgggttccaacgct
gaagctctggctgttatcgctgaagctgttaaagctgctggttatgaactgggcaaagac
atcactctggcgatggactgcgcagcttctgaattctacaaagacggtaaatacgttctg
gctggcgaaggcaacaaagctttcacctctgaagaattcactcacttcctggaagaactg
accaaacagtatccgatcgtatctatcgaagacggtctggacgaatctgactgggacggt
ttcgcataccagaccaaagttctgggcgacaaaatccagctggttggtgacgacctgttc
gtaactaacaccaagatcctgaaagaaggtatcgaaaaaggtatcgctaactccatcctg
atcaaattcaaccagatcggttctctgaccgaaactctggctgcaatcaagatggcgaaa
gatgctggctacactgcagttatctctcaccgttctggcgaaactgaagacgctaccatc
gctgacctggctgttggtactgctgcaggccagatcaaaactggttctatgagccgttct
gaccgtgttgctaaatacaaccagctgattcgtatcgaagaagctctgggcgaaaaagca
ccgtacaacggtcgtaaagagatcaaaggccaggcataa

DBGET integrated database retrieval system