KEGG   Escherichia coli KO11FL: EKO11_0990
Entry
EKO11_0990        CDS       T01718                                 

Definition
(GenBank) protein of unknown function DUF477
  KO
K06872  uncharacterized protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EKO11_0990
SSDB
Motif
Pfam: TPM_phosphatase DUF5130 MOLO1
Other DBs
NCBI-ProteinID: ADX49625
Position
complement(1046036..1046908)
AA seq 290 aa
MRYFILMFTFVCSFVAAQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIA
VLIVPTTKDETIEQYATRVFDNWRLGDAKRNDGILIIVAWSDRTVRIQVGYGLEEKVTDA
LAGDIIRSNMIPAFKQQKFAQGLELAINALNSQLTSQHQYPTNPSESESASSSDHYYFAI
FWVFAVMFFPFWFFHQGSNFCRACKSGVCISAIYLLDLFLFSDKIFSIAVFSFFFTFTIF
MVFTCLCVLQKRASGKSYHSDNSGSGGGSSGGGFSGGGGSSGGGGASGRW
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgctatttcatactaatgttcactttcgtatgttcctttgttgcagcccaaccaact
attgtcccacaattacagcaacaagttacggatcttacgagtagcttaaactcacaagaa
aagaaagaactgacgcacaagttagaatctattttcaataatacccaagtgcaaattgct
gtattaattgttcccacaaccaaagacgagacaattgaacaatatgctacaagagttttt
gacaattggcgtttaggagatgccaaacgtaatgatgggatactgatcattgttgcctgg
tcagatcgtactgtccgcatccaggtaggttatgggctggaagaaaaggtaaccgatgct
ctggctggagatatcatccgtagcaacatgatacccgcatttaaacaacaaaaatttgct
cagggattagagctagctataaacgctttgaatagccaactcacttcacaacaccaatat
ccgactaatccttcagaaagtgaatcagcgtcttccagtgatcattattactttgctatt
ttttgggtatttgcagtgatgttcttccctttctggttttttcatcaaggcagtaatttt
tgtcgcgcatgtaaaagtggagtctgtatttcagcaatctatcttttagatttattcctg
ttctccgataaaattttttccattgctgtattttccttcttttttactttcaccatattt
atggtctttacctgtttatgtgtacttcagaaaagagcatcaggtaaaagttatcattca
gacaacagcggttccggtggaggctcaagtggcggcggatttagcggcgggggcggttct
tctggaggtggcggcgcatccggccgctggtaa

DBGET integrated database retrieval system