KEGG   Escherichia coli KO11FL: EKO11_0992
Entry
EKO11_0992        CDS       T01718                                 

Definition
(GenBank) Radical SAM domain protein
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00790  Folate biosynthesis
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EKO11_0992
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eko03016]
    EKO11_0992
Enzymes [BR:eko01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     EKO11_0992
Transfer RNA biogenesis [BR:eko03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EKO11_0992
SSDB
Motif
Pfam: Fer4_14 Radical_SAM Fer4_12
Other DBs
NCBI-ProteinID: ADX49627
Structure
PDB: 
6NHL

Position
1047201..1047872
AA seq 223 aa
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAK
TKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETS
GTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTD
DKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcagtacccgattaacgagatgttccagaccctgcaaggtgagggttactttaccggc
gtccccgccatttttattcgtttacagggatgcccggttggctgtgcctggtgcgacacc
aaacacacctgggaaaagcttgaggatcgggaagtctcccttttcagcattctggcgaag
accaaagagagtgataagtggggggcggcgagcagtgaagatttgctggctgtcattggt
cggcagggatataccgcgcggcatgtggtgattacgggtggtgagccttgcattcatgat
ttgctgccactgactgacctgctcgaaaaaaacggttttagctgccagatcgaaaccagt
ggaactcatgaagtacgctgcacaccgaatacctgggttaccgtatcaccaaagctgaac
atgcgcggcggctatgaagtgttgtcacaggcactggagcgagccaacgaaatcaagcat
ccagtggggcgcgtacgtgatattgaagcactggatgaactactggcaacgctgaccgat
gataaaccgcgagtcattgcactgcagccgattagccaaaaggatgatgccacacgtttg
tgcattgaaacctgcattgcgcgtaattggcgtttgtcgatgcaaacacataaatatcta
aatattgcctga

DBGET integrated database retrieval system