KEGG   Escherichia coli KO11FL: EKO11_0993
Entry
EKO11_0993        CDS       T01718                                 

Definition
(GenBank) Carbohydrate kinase, FGGY-like protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: FGGY_C FGGY_N BcrAD_BadFG
Other DBs
NCBI-ProteinID: ADX49628
Position
complement(1049490..1050968)
AA seq 492 aa
MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPDADTAEHPDDDLWASLCFA
GHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADGTLAAPLISWQDARVTRPYEHTNPDVA
YVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKSWTWSEDAAVMDKFNIPRHMLFDVQMP
GTVLGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDDETAVISLGTYIALMMNGK
ALPKDPVAYWPIMSSIPQTLLYEGYGIRKGMWTVSWLRDMLGESLIQDARAQDLSPEDLL
NKKASSVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSMDYAWIYRSILESVALTLKNN
YDNMCNEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPARRNAINGCASLGAAINTAVGL
GLYPDYATAVDKMVRVKDIFIPIESNAKRYDAMNKGIFKDLTKHTDVILKKSYEVMHGEL
GNVDSIQSWSNA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtcgaaaaaatacatcatagggattgatggcggaagtcagagcacaaaagtggtgatg
tacgatctggaaggtaacgtggtttgcgaaggcaaaggcttattacagccgatgcacacg
ccagatgccgatactgcagaacatcctgacgacgatttatgggcatcattatgttttgcc
ggtcacgatttgatgagtcagtttgccgggaataaagaagatattgtcggtattggtctg
ggatccatccgttgctgtcgtgcgttattgaaagccgatggcacgcttgctgcgccgttg
attagctggcaggatgcacgcgttacacgcccttacgaacacactaatcctgacgtggca
tatgtcacctctttttcgggttatctgacgcatcgcttaaccggcgagtttaaagacaat
atcgccaactattttggtcagtggccggtggattataagagctggacatggagcgaagat
gctgcggtaatggataagtttaatatcccccgtcatatgctgtttgatgtgcaaatgcct
ggcaccgtcctcggacatatcacaccacaagccgcactggcgacacatttcccggcagga
ctgccggttgtttgtaccaccagtgataaaccggtagaagctctgggggccggattactg
gatgatgaaactgcggtaatttctcttggcacttacatcgcattgatgatgaacggcaaa
gcactgccgaaagatccggtggcgtactggccgattatgtcttctattccgcaaacattg
ctgtatgaaggttacggtattcgcaaaggtatgtggacggtgagctggctgcgtgacatg
ttaggcgagtcgttaattcaggatgccagggcgcaggatctttcaccggaagatttactc
aacaagaaagcctctagtgtgccacctggctgtaatgggctgatgacggtgctggactgg
ctgaccaatccgtgggaaccgtacaaacgcgggattatgatcggctttgattccagcatg
gattacgcatggatatatcgttcgatattggaaagcgtggcgctaacgctgaagaacaat
tacgacaatatgtgtaatgaaatgaatcactttgcgaagcatgtgatcattactggcggc
ggttcgaacagcgatctgtttatgcaaatttttgccgacgtgttcaaccttccggcacgc
cgtaacgccattaacggttgtgcaagtctgggagcagcgattaatacagcggtaggtctg
gggctatacccggattacgcaacggctgttgataagatggttcgcgtgaaagatatcttt
ataccgattgagagcaatgccaaacgctacgacgcgatgaataaaggcattttcaaagac
ctaaccaaacatactgatgtgatcctgaaaaaatcgtatgaagtgatgcatggggaattg
gggaatgtggattcgatccagagctggtcgaatgcgtaa

DBGET integrated database retrieval system