KEGG   Escherichia coli KO11FL: EKO11_0994
Entry
EKO11_0994        CDS       T01718                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: MFS_1 MFS_1_like MFS_2 Nuc_H_symport Abhydrolase_9_N
Other DBs
NCBI-ProteinID: ADX49629
Position
complement(1050995..1052272)
AA seq 425 aa
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAII
LYAPSGVIADKFSHRKMITSAMIITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVS
IKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSASLKTVIIIYSVV
YILLGILCWFFVSDNNNLRSANNEEKQSFQFSDILAVLRISTTWYCSMVIFGVFTIYAIL
SYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVIQILSVLG
LLALTALLVTNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICS
VIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALAMVIVFTFLLFQKIRTAESAPA
MASSK
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcaacacaactcatatcgccgttggataaccctcgcgataattagttttagcggcggc
gttagttttgacctggcttatttacgttatatttatcaaattcccatggcgaaatttatg
ggattcagcaataccgagataggtttaataatgagtacctttggtattgcggctattatt
ctttatgcccccagcggcgttattgccgataaattttcacaccgcaaaatgattacttcc
gcgatgatcattaccggattactgggtctgttaatggcaacgtatccaccgctgtgggta
atgctctgtattcaggtcgcctttgcgataacgacgattttaatgctgtggtcggtgtcg
attaaagccgcctcgttgctgggcgatcatagtgagcaagggaaaattatgggctggatg
gaagggctgcgcggcgtcggtgtaatgtcgctggcggtgtttaccatgtgggtcttttct
cgctttgcaccggatgacagcgccagcctgaaaacagtcattatcatctacagtgtggtt
tacatcttgttggggattctgtgctggttttttgttagcgataacaacaacctgcgcagt
gccaataacgaagaaaaacagtcattccagtttagcgacatccttgccgttttgcgtatc
agcaccacctggtattgcagcatggtgatttttggtgtcttcacaatctacgccattctg
agttactccaccaactatctgaccgaaatgtacggcatgtcgctggtggcagcgagctac
atggggattgtgatcaacaaaatcttccgcgcgctgtgcggcccacttggcggcattatc
accacctacagtaaagtgaaatcccctacccgcgtgatccaaatcctttccgtactcggc
ctgctggcgttaactgccctgctcgtcacgaactctaacccgcaatcggtcgcgatgggg
attggcctgattttactgctgggattcacctgttacgcctcacgcgggctgtactgggcc
tgccctggcgaagcgagaacaccgtcttacattatgggcaccacggtaggtatttgttcg
gtgattggattcctgccggatgtcttcgtttacccgattatcggccactggcaagacacc
ctgcccgcagcagaagcctaccgcaatatgtggctgatgggaatggcggcgcttgccatg
gtgattgtctttacctttttgctgttccaaaaaattcgtactgctgagagcgcccccgca
atggctagcagcaagtaa

DBGET integrated database retrieval system