KEGG   Escherichia coli KO11FL: EKO11_0995
Entry
EKO11_0995        CDS       T01718                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: adh_short_C2 adh_short KR PALP
Other DBs
NCBI-ProteinID: ADX49630
Position
1052591..1053376
AA seq 261 aa
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEM
IEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDP
MIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAY
CDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLA
SPASNYVNGHLLVVDGGYLVR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcaatcgaatctctcaatgcgttctcaatggattttttctcactgaaaggtaaaacc
gcaattgttaccggtgggaatagcggtttaggccaggcatttgccatggcgttggccaaa
gctggcgcaaatatctttattcctagtttcgtcaaagataacggcgaaacaaaggaaatg
attgaaaaacagggtgttgaggtggacttcatgcaggtggatatcaccgcagaaggcgcg
ccgcagaagattatcgctgcttgctgtgagcgtttcggtacagttgatattctggtaaac
aatgccggtatttgtaagctgaataaggtgctggacttcggtcgtgccgactgggatccg
atgattgatgtgaacctgaccgccgcattcgagttaagctatgaagctgcaaaaattatg
atcccgcagaaaagcggcaaaattattaatatctgttcattgttctcttacttaggtgga
caatggtcacctgcatattctgccactaaacatgctcttgccgggttcaccaaagcttat
tgtgatgagctaggtcaatataatattcaggtaaatggtatcgcccctggctattatgca
acagatattacgctggcgacacgcagtaatccagaaaccaatcagcgcgttcttgatcat
attccggcaaaccgttggggcgatactcaggatttaatgggcgcagctgtattcctcgca
agtccggcttcaaattatgtcaatgggcatttattagtggtcgatggtggttatttagtg
cgctaa

DBGET integrated database retrieval system