KEGG   Escherichia coli KO11FL: EKO11_0996
Entry
EKO11_0996        CDS       T01718                                 

Definition
(GenBank) Alkylglycerone-phosphate synthase
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: FAD_binding_4 FAD-oxidase_C Cytokin-bind
Other DBs
NCBI-ProteinID: ADX49631
Position
1053446..1054900
AA seq 484 aa
MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGIYTLPIPAAVVKLGST
EQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATA
QCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEA
VLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKFTPENNLFYGYILED
MKTGFNILREVMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNPRIAKATGEG
IAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIH
EIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVDCKPEEEIDKYHNP
LNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTIY
PIEK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtctttatctcgcgcagcgattgtcgaccagctaaaggaaattgttggtgcagatcgc
gtaattaccgatgaaacagtattaaagaagaacagtattgaccgttttcgtaaatttccg
gatattcatggtatttatactttgccgattccggcagcggtcgtaaaactcggttccaca
gaacaagtctcccgtgtgctgaattttatgaatgcgcacaaaattaacggtgtgccgcgt
accggcgcttccgccactgaaggtgggctggaaaccgttgtggaaaactcggtggtgctc
gacggctccgccatgaatcaaatcattaatattgatattgagaatatgcaggcgacggcg
caatgtggcgttccgctggaggtgctggaaaatgcgttgcgtgaaaaaggttacaccacg
gggcattctccgcagtcaaagccgctggctcagatgggcggcctggtagcaacccgcagt
atcgggcagttctccacactctacggcgcaatcgaagatatggtcgttggtctggaagca
gtattggctgatggcaccgtcacacgcattaaaaacgtgccacgccgcgcggctggcccg
gacattcgccacatcatcatcggtaacgaaggtgcactttgctatatcactgaagtaaca
gtgaaaatctttaaattcaccccggaaaacaacctcttctacggctatatcctggaagac
atgaaaaccggcttcaacatcctgcgtgaagtcatggtggaagggtatcgtccgtcgatc
gctcgtttgtatgacgctgaagatggcacccaacacttcacccattttgcagacggaaaa
tgcgtgctgatctttatggctgaaggtaaccctcgcattgcgaaggcgacgggcgaaggg
attgcggaaatcgttgcccgctacccgcaatgccagcgcgtggacagcaagctgatcgaa
acctggtttaacaacctgaactggggaccggataaagtggctgccgaacgtgtgcagatc
ctcaaaaccggcaacatgggctttaccactgaagtgtccggctgctggagctgcatccac
gaaatctacgaaagcgttattaaccgtattcgtactgagttcccgcacgccgacgacatc
accatgctgggcggtcattcctctcatagctatcagaacggcaccaacatgtacttcgtc
tacgattacaacgtcgttgactgtaagccggaagaggaaatcgacaagtaccacaatccg
ctcaacaagatcatctgtgaagaaaccattcgcctcggcggttcgatggtgcaccaccac
ggtatcggtaaacatcgcgttcactggagcaaactggaacacggcagcgcgtgggcgttg
ctggaagggctgaaaaagcagttcgatcctaatggcattatgaatacgggtactatctat
ccgattgaaaaataa

DBGET integrated database retrieval system