KEGG   Escherichia coli KO11FL: EKO11_0997
Entry
EKO11_0997        CDS       T01718                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08368  MFS transporter, putative metabolite transport protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eko02000]
    EKO11_0997
Transporters [BR:eko02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    EKO11_0997
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-ProteinID: ADX49632
Position
1054922..1056331
AA seq 469 aa
MTGRCLFGFSGEKPFLLPDNEGVKMNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLG
VIGYAIIQLTPAMQLTPFMAGMIGGSALLGLFLGSLVLGWISDHIGRQKIFTFSFLLITL
ASFLQFFATTPEHLIGLRILIGIGLGGDYSVGHTLLAEFSPRRHRGILLGAFSVVWTVGY
VLASIAGHHFISENPEAWRWLLASAALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVH
RYFGPHVLLGDEVVTATHKHIKTLFSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQT
IGLEDALTASLMLNALLIVGALLGLVLTHLLAHRKFLLGSFLLLAATLVVMACLPSGSSL
TLLLFVLFSTTISAVSNLVGILPAESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQ
WGMQVTLLLLATVLLVGFVVTWLWAPETKALPLVAAGNVGGANEHSVSV
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgacggggcgttgccttttcggcttctcaggcgagaagccgttcttattaccggacaat
gaaggggtaaagatgaacacttcaccggtgcgaatggatgatttaccgcttaaccgtttt
cactgccgcattgctgcgctcactttcggcgcacacctgaccgacggttatgttctcggc
gtcattggttacgccattattcagcttacgcccgccatgcaactgacgccgtttatggcg
ggaatgatcggcggctcggcgctccttggtttgttccttggcagcctggttcttgggtgg
atctccgaccatattggtcggcaaaaaatcttcaccttcagctttttgctgattacgctt
gcttcgtttttacaattttttgccaccacgccagagcatcttattggactgcgcattttg
attggcattggtctgggaggcgattattcagtaggtcacaccttgctggctgaattttcc
ccgcgccgccatcgcggtattttgctgggcgcattcagcgtggtgtggaccgtaggctat
gtgctggcaagtattgccggacatcactttatttccgaaaacccggaggcctggcgctgg
ctactggcatcggcagctctgcccgcgttgttgattacgttattacgctggggaacgcca
gaatcaccacgctggctactgcgccaggggcgttttgcagaagctcacgctatcgtgcat
cgctattttggtccccatgttttactgggcgatgaagtggtaacggcgacccataaacac
atcaaaaccttgttctcttcgcgttactggcggcgcacggcgtttaacagcgtcttcttt
gtctgcctcgtaatcccatggtttgtgatttatacctggctgccaactatcgcccagact
attggtctggaagatgcgctgactgccagcctgatgcttaatgcgttgttaattgtgggc
gcgctgctgggattagttctgacgcacctgctggcacatcgcaaatttttgctgggaagt
tttttgctgctggcggcaacgctggtagtcatggcctgtttgccttccggcagttcatta
acgctgctgctttttgttctcttcagcaccaccatttcggcagtcagtaatctggtgggc
attttgcctgcggaaagttttcctactgacattcgctcgctgggcgtcggttttgccacc
gccatgagtcgacttggcgcggcggtaagtactggcctgctgccgtgggtgctggcgcag
tggggaatgcaagtcaccttattgctcctggcgacagtgttgttggttggttttgttgtg
acctggctatgggcaccagaaactaaagccctcccgctggtggcggcgggaaatgtagga
ggtgcgaatgaacattctgttagcgtttaa

DBGET integrated database retrieval system