KEGG   Escherichia coli KO11FL: EKO11_0998
Entry
EKO11_0998        CDS       T01718                                 

Definition
(GenBank) Electron transfer flavoprotein alpha/beta-subunit
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: ETF
Other DBs
NCBI-ProteinID: ADX49633
Position
1056309..1057088
AA seq 259 aa
MNILLAFKAEPDAGMLAEKEWQAAAQGKSGPDISLLRSLLGADEQAAAALLLAQRKNGTP
MSLTALSMGDERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQHQNPLDLI
ITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDALFITLEQRTEHGLRCCRVRLPAV
IAVRQCGEVALPVPGMRQRMAAGKAEIIRKTVAAEMPAMQCLQLARAEQRRGATLIDGQT
VAEKAQKLWRDYLRQRMQP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaacattctgttagcgtttaaagccgaaccggatgccggaatgctggcggaaaaagag
tggcaggcggcggctcagggtaaaagcggaccggatatttcgctactgcgaagtttactc
ggtgctgatgaacaggccgctgccgcgctgctgttggcgcagagaaaaaacggtacgccg
atgtctttaaccgcgttgagcatgggggatgaacgggcattgcactggctgcgctatctc
atggctcttgggtttgaggaagctgtattgctggagacggcggcagatctgcgctttgcg
ccggaatttgtcgctcgccatattgccgaatggcagcatcagaatccgctggatctgata
attaccggctgccaaagcagcgaagggcagaatgggcaaacgccatttttgctggcggaa
atgctgggctggccctgcttcacccaggtggagcgtttcactctcgacgcgctgtttatc
accctcgaacagcgtactgaacatggtttgcgttgttgccgggttcgcttgcctgcggtg
attgccgtgcgtcagtgcggtgaagtggccttgccagtaccgggaatgcgccagcgaatg
gccgcggggaaagcagaaattatccgtaaaactgttgctgccgaaatgccagcgatgcag
tgtctgcaactggcaagagcagagcaacgacgcggagcgacgctgattgatgggcaaacg
gtagcagaaaaagctcaaaagctatggcgggactatttacgccaaaggatgcagccatga

DBGET integrated database retrieval system