KEGG   Escherichia coli KO11FL: EKO11_0999
Entry
EKO11_0999        CDS       T01718                                 

Definition
(GenBank) Electron transfer flavoprotein alpha subunit
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: ETF_alpha ETF
Other DBs
NCBI-ProteinID: ADX49634
Position
1057085..1057945
AA seq 286 aa
MNIAIVTINQENAAIASWLAAQDFSGCTLAHWQIEPQPVVAEQVLDALVEQWQRTPADVV
LFPPGTFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGNALTATLQTEKRPLCLS
LARQAGAAKNATLPSGMQQLNIVPGALPDWLVSTEDLKNVTRDPLAEARRVLVVGQGGEA
DNQEIAMLAEKLGAEVGYSRARVMNGGVDAEKVIGISGHLLAPEVCIVVGASGAAALMAG
VRNSKFVVAINHDASAAVFSQADVGVVDDWKVVLEALVTNIHADCQ
NT seq 861 nt   +upstreamnt  +downstreamnt
atgaatatcgcaattgtgacaataaatcaggagaatgccgcaatagcaagctggctggcg
gcgcaggatttcagcggttgtaccctggcgcactggcagattgaacctcagcctgtagtg
gcggaacaggtgctggatgcgttggtggaacagtggcagcgaacgcctgcggacgttgtt
ctctttccgccgggaacgtttggcgatgaactgtcgacccggctggcctggcgtttacat
ggtgcaagcatctgccaggtgacttcgttagatattccaaccgtaagcgtgcgcaaatcc
cactggggaaatgcgctaacggcgacgctgcaaacagaaaaacgcccgctatgcctttcc
ctggcgcgtcaggcgggagcagcgaaaaacgccacgttgccctctggaatgcaacaactg
aacattgtcccgggtgcgcttcccgactggctggttagcacagaggatctgaaaaatgtt
actcgcgacccattagctgaggccagacgggtgctggtggtggggcagggcggagaggca
gataaccaggaaatcgctatgctggcagaaaagctgggagccgaagtgggctacagtcgg
gcgcgagtgatgaacggtggcgttgatgctgaaaaagtgattggtatttccggacatctg
ctggcacctgaggtgtgtattgttgttggcgcttctggcgcagcagcgttaatggcgggc
gtacgcaatagcaagtttgtggtggcgattaatcatgacgccagcgctgcggtattttca
caggcagatgttggcgtggttgatgactggaaagtggtgctggaggcactggtgacaaac
attcacgcagattgccaataa

DBGET integrated database retrieval system