KEGG   Escherichia coli KO11FL: EKO11_1000
Entry
EKO11_1000        CDS       T01718                                 

Definition
(GenBank) glycerol-3-phosphate responsive antiterminator, GlpP
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: G3P_antiterm FMN_dh
Other DBs
NCBI-ProteinID: ADX49635
Position
complement(1058093..1058668)
AA seq 191 aa
MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIH
VDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNID
KQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTN
TGVWTLAKKLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcccctcttacacctgctccgccagaatccggtgattgctgccgttaaagataatgcc
agcctgcaactggctatcgattctgaatgccagtttatttccgtgttgtacggcaatatc
tgcaccatcagtaatatcgttaaaaagattaagaacgccgggaaatatgcttttattcat
gttgatttgctggaaggcgcgtcaaataaagaagtcgttattcagtttttgaaactggtg
accgaggcggacggcattatcagtaccaaagcctcaatgttgaaagcggcaagagcggaa
ggttttttctgtattcatcgcctgtttattgttgattcaatttcgtttcacaacattgat
aagcaagttgcgcaatcgaatccggattgtattgagatcctgccaggctgtatgcccaaa
gtgctgggctgggtgacagagaaaatccgccaaccgctgattgccggtgggctggtgtgc
gatgaagaagatgcgcgtaatgcgattaacgcgggtgtcgtggcgctttccaccacgaat
accggggtctggacgttagcgaaaaaattactttga

DBGET integrated database retrieval system