KEGG   Escherichia coli KO11FL: EKO11_1001
Entry
EKO11_1001        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
  KO
K03855  ferredoxin like protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EKO11_1001
SSDB
Motif
Pfam: Fer4_9 Fer4_21 ETF_QO Fer4_7 Fer4_19
Other DBs
NCBI-ProteinID: ADX49636
Position
complement(1058685..1058945)
AA seq 86 aa
MSVAHNLWRVADAPHIVPADSVERQMVQRLINACPAGLFSLTPEGDLRVDYHGCLECGTC
RLLCDESTLQQWRYPPSGFGITYRFG
NT seq 261 nt   +upstreamnt  +downstreamnt
atgtctgtagcccataatctctggcgcgttgctgatgcgccgcacattgttccggctgac
tccgttgagcgtcagatggtacaacggttgattaacgcctgtccggcaggtcttttttcg
ctcacaccggaaggtgacttacgcgttgattatcacggctgcctggagtgtggcacctgc
cgtttgctgtgcgacgaatccacactacaacagtggcgctatccgccttccggattcggc
atcacctaccgctttggataa

DBGET integrated database retrieval system