KEGG   Escherichia coli KO11FL: EKO11_1002
Entry
EKO11_1002        CDS       T01718                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00313  electron transfer flavoprotein-quinone oxidoreductase [EC:1.5.5.-]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1002
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.-  
     EKO11_1002
SSDB
Motif
Pfam: DAO HI0933_like FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 NAD_binding_8 GIDA Lycopene_cycl Trp_halogenase Thi4 Pyr_redox_3 3HCDH_N DUF5879
Other DBs
NCBI-ProteinID: ADX49637
Position
complement(1058936..1060207)
AA seq 423 aa
MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLSGGRLYTHALAELLPQ
FHLTAPLERRITHESLSLLTPDGATTFSSLQPGGESWSVLRARFDPWLVAEAEKEGVECI
PGATVDALYEENGRVCGVICGDDILRARYVVLAEGANSVLAERHGLVTRPAGEAMALGIK
EVLSLETSAIEERFHLENNEGAALLFSGGICDDLPGGAFLYTNQQTLSLGIVCPLSSLTQ
SRVPASELLTRFKAHPAVRPLIKNTESLEYGAHLVPEGGLHSMPVQYAGNGWLLVGDALR
SCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFALYHHNVERSLLWDILQRYQH
VPALLQRPGWYRAWPALMQDISRDLWDQGDKPVPPLRQLFWRHLRRHGLWHLAGDVIRSL
RCL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggaagacgactgcgacattattattattggtgccggtattgcaggcaccgcttgcgcg
ttacgctgcgcgcgagcgggtttatccgttttgttactggaacgcgctgaaatccccggc
agcaaaaatctttccggcgggcggttatatacccatgcactcgcggaactcctcccgcaa
tttcacctgaccgcgcctcttgaacgacgcatcactcacgaaagcctttccctgttaacg
ccggatggtgcaacgacgttttccagcttacagcccggcggtgaatcctggagtgtatta
cgtgcacggttcgatccgtggctggttgccgaagccgaaaaagaaggtgtcgaatgcatc
cccggtgcgacggtggatgcgctgtatgaagaaaacggcagggtgtgtggtgtcatttgt
ggtgacgatattctccgcgcccgttatgtggtgctggcagaaggtgccaacagcgtcctg
gctgaacgtcacgggttagtgactcgtcctgctggcgaagcgatggcgttggggatcaaa
gaagtgctgtcgctggaaacatccgctattgaagaacgttttcatctggagaataacgaa
ggcgcagcgttgctgttcagcggcggaatctgtgatgacttacccggcggcgcatttctt
tatactaatcaacaaacgctctcgttagggattgtttgcccgctctcttcccttacgcaa
agtcgtgttccggcaagcgagttgctgactcgctttaaagcgcatccggcagtgcgcccg
cttatcaaaaacacggaatcactggagtatggtgcgcatctggtgccagaaggtggcttg
cacagtatgccggtgcaatacgccggtaacggctggctgctggtgggcgatgcgttgcgc
agttgcgtcaataccggaatttccgtgcgcggcatggatatggcgctgactggcgcacag
gcggcggcacaaacgctgataagcgcctgccagcaccgcgagccgcaaaatctgtttgcg
ctttatcatcacaacgtcgagcgcagcctgctatgggatattctacagcgttatcagcat
gttccggcgcttttgcaacgccctggctggtatcgggcgtggcctgcgttaatgcaggat
atttcccgcgatttatgggatcagggtgataaacctgttccaccgctgcgccagttattc
tggcgtcatttacgtcgtcatggcctgtggcatctggcgggcgatgttatcaggagtctg
cgatgtctgtag

DBGET integrated database retrieval system