KEGG   Escherichia coli KO11FL: EKO11_1003
Entry
EKO11_1003        CDS       T01718                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00790  Folate biosynthesis
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EKO11_1003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eko03016]
    EKO11_1003
Enzymes [BR:eko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     EKO11_1003
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     EKO11_1003
Transfer RNA biogenesis [BR:eko03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    EKO11_1003
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: ADX49638
Structure
PDB: 

Position
complement(1060285..1060734)
AA seq 149 aa
MRNKVVLDNAKKQPFRYSTAVLSSCREIMMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHG
HSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWI
WDQVKPVVPLLSAVMVKETCTAGCIYRGE
NT seq 450 nt   +upstreamnt  +downstreamnt
ttgcgcaacaaagtcgttttagataatgcgaaaaaacagcctttccggtactctacggcg
gttttatcgtcctgtagagaaattatgatgtccaccacgttatttaaagatttcaccttc
gaagccgctcaccgcttaccacacgtcccggaagggcataaatgtggtcgcctgcacggg
cattcctttatggtgcgactggaaattaccggggaagtcgatccgcatacgggctggatt
atcgatttcgctgaactgaaagcggcgtttaagccaacttatgagcgcctcgatcaccat
tatctcaatgatattccaggtctggaaaacccaaccagcgaagttttagcaaaatggatt
tgggatcaggttaaacccgttgtgccgctgttaagtgcggtgatggtaaaagaaacctgt
accgcaggttgtatctatcgcggcgaatga

DBGET integrated database retrieval system