KEGG   Escherichia coli KO11FL: EKO11_1005
Entry
EKO11_1005        CDS       T01718                                 

Definition
(GenBank) sulfite reductase (NADPH) hemoprotein, beta-component
  KO
K00381  sulfite reductase (NADPH) hemoprotein beta-component [EC:1.8.1.2]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00920  Sulfur metabolism
eko01100  Metabolic pathways
eko01120  Microbial metabolism in diverse environments
Module
eko_M00176  Assimilatory sulfate reduction, sulfate => H2S
eko_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EKO11_1005
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     EKO11_1005
SSDB
Motif
Pfam: NIR_SIR NIR_SIR_ferr
Other DBs
NCBI-ProteinID: ADX49640
Structure
PDB: 

Position
1062765..1064477
AA seq 570 aa
MSEKHPGPLVVEGKLTDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQ
DDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAGENTIYGSIRLTNRQTF
QFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHAEAYEWAKKISEH
LLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAI
AENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRT
DRKNAKTKYTLERVGVETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDDNWHLTL
FIENGRILDYPGRPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGL
MNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCP
NGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAK
EREAGEGFGDFTVRAGIIRPVLDPARDLWD
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgagcgaaaaacatccagggcctttagtggtcgaaggaaaactgacagacgccgagcgc
atgaagcttgaaagcaactacctgcgcggcaccattgcggaagatttaaacgacggtctg
accggcggctttaagggcgacaacttcctgctgatccgcttccacggcatgtatcagcag
gatgaccgcgacatccgcgccgaacgtgctgaacagaagctggagccgcgccacgcgatg
ctgcttcgctgtcgtctgccgggtggggtgattaccactaaacagtggcaggcgatcgac
aaatttgccggtgaaaacaccatctatggcagcattcgcctgaccaaccgccagacgttt
cagttccacggcattctgaaaaagaacgtcaaaccggtgcaccagatgctgcactcggtt
ggtcttgatgcgctggcgaccgctaacgacatgaaccgtaacgtactctgcacctcgaac
ccttacgagtcgcagctacacgcggaagcgtatgaatgggcgaagaaaatctctgaacat
ctgctgccgcgtacccgcgcgtatgcggagatctggctcgatcaggaaaaagtcgccacc
accgatgaagaaccgatccttggtcagacctacctgccgcgtaagttcaaaaccacggta
gtgatcccgccgcagaacgatatcgatctgcatgccaacgacatgaacttcgtggcaatc
gccgaaaacggcaagctggtaggcttcaacctgctggtgggcggtgggctttctatcgaa
cacggcaacaagaaaacctacgcccgcacggcgagcgagtttggctatctgccgctggag
catacgctggcggtggccgaagccgtcgtgacaactcagcgtgactggggtaaccgaacc
gatcgtaaaaatgccaaaaccaaatacacgctggagcgcgtgggggttgagacgtttaaa
gcggaagtggagcgtcgcgcggggatcaaatttgaaccgatccgtccatatgagttcacc
ggacgaggcgatcgtattggctgggttaagggcattgatgataactggcacctgacgctg
tttatcgaaaatggtcgcatccttgattatccggggcgtccgctgaaaaccggcctgctg
gagatcgcgaagatccacaaaggcgatttccgcattacggcgaaccagaatctgatcatc
gccggtgtaccggaaagcgagaaagcgaagatcgagaagatcgccaaagagagcgggtta
atgaatgccgtcacgccgcagcgtgaaaactcgatggcctgcgtctcgttcccgacttgc
ccgctggcgatggcggaagcagagcgtttcctgccgtcttttatcgacaacatcgataat
ttaatggcgaaacatggtgtcagcgatgagcatatcgtgatgcgtgtaacaggctgcccg
aacggttgtggtcgcgcgatgctggcggaagtgggcctggtgggtaaagcgccgggtcgc
tacaacctgcatcttggcggcaaccgcattgggacacgtatcccacggatgtataaagaa
aacatcaccgagccggaaatcctggcgtcgcttgatgaactgatagggcgctgggcgaaa
gagcgcgaagcgggtgaaggcttcggcgactttacggtgcgtgcgggcatcattcgcccg
gtgctcgatccggcgcgcgatttgtgggattaa

DBGET integrated database retrieval system