KEGG   Escherichia coli KO11FL: EKO11_1006
Entry
EKO11_1006        CDS       T01718                                 

Definition
(GenBank) phosphoadenosine phosphosulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00920  Sulfur metabolism
eko01100  Metabolic pathways
eko01120  Microbial metabolism in diverse environments
Module
eko_M00176  Assimilatory sulfate reduction, sulfate => H2S
eko_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EKO11_1006
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     EKO11_1006
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     EKO11_1006
SSDB
Motif
Pfam: PAPS_reduct LisH YceG
Other DBs
NCBI-ProteinID: ADX49641
Structure
PDB: 
1SUR 2O8V

Position
1064551..1065285
AA seq 244 aa
MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAV
SLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKL
WEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVL
PIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMSEEETRFFGLKRECG
LHEG
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtccaaactcgatctaaacgccctgaacgaactgccgaaggtagatcgcattctggcg
ctggcagaaactaacgccgaactggaaaaactggacgctgaaggccgcgttgcctgggcg
ctggataatctgcccggtgaatatgtactttcttccagctttggcattcaggcggcggtg
agcctgcatctggtgaatcagattcacccggatattccggtgatcctcaccgacaccggc
tatctgttcccggaaacctaccgctttattgacgagttaacggacaaactcaagctcaac
ctgaaagtgtaccgcgctaccgaaagcgccgcctggcaggaagcacgctacggcaaactg
tgggaacagggcgttgaaggcattgaaaagtacaatgacatcaacaaagtcgaaccgatg
aaccgggctctgaaagaacttaacgcgcaaacctggtttgctggcctgcgccgtgaacaa
tccggcagtcgcgccaatttaccggtgctggcaattcagcgtggcgtatttaaagtgctg
ccgattatcgactgggataaccgaactatttatcagtacctgcaaaaacatggcctgaaa
tatcacccattatgggatgaaggatatttatcggtcggtgatacccatacaacccgtaaa
tgggaacctggcatgtcggaagaagaaacacgtttctttggcttaaaaagggaatgtgga
ttgcacgaagggtaa

DBGET integrated database retrieval system