KEGG   Escherichia coli KO11FL: EKO11_1007
Entry
EKO11_1007        CDS       T01718                                 

Definition
(GenBank) Hok/gef cell toxic protein
  KO
K18922  protein HokE
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1007
Prokaryotic defense system [BR:eko02048]
 Toxin-antitoxin system (TA system)
  Type I TA system
   Hok-Sok
    EKO11_1007
SSDB
Motif
Pfam: HOK_GEF DUF1270
Other DBs
NCBI-ProteinID: ADX49642
Position
1065550..1065702
AA seq 50 aa
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
NT seq 153 nt   +upstreamnt  +downstreamnt
atgctgacaaaatatgcccttgtggcaatcatagtgctgtgttttacagtactgggattc
acgctgatggtaggcgactcgttgtgtgagttgagtatcagagaacgtggtatggagttt
aaggcagttctcgcttacgaatcgaagaagtag

DBGET integrated database retrieval system