KEGG   Escherichia coli KO11FL: EKO11_1008
Entry
EKO11_1008        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated helicase Cas3
  KO
K07012  CRISPR-associated endonuclease/helicase Cas3 [EC:3.1.-.- 3.6.4.-]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1008
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EKO11_1008
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EKO11_1008
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Type I signiture cas proteins
    EKO11_1008
SSDB
Motif
Pfam: HD_6 DEAD Helicase_C ResIII
Other DBs
NCBI-ProteinID: ADX49643
Position
1065897..1068596
AA seq 899 aa
MRKYPLSLLKDKNIVTFFDFWGKTRRGEKDGGDDYHLLCWHSLDVAAMGYLMVKRNCFGL
ADYFRQLGISDKEQAAQFFAWLLCWHDIGKFARSFQQLYLPPELKIQEGARKNYEKISHS
TLGYWLWNHYLSECQELLPSSSLSPRKLRRVIEMWMPVTTGHHGRPPDRMDELDNFLPED
KAAARDFLLEIKPLFPLIEIPAFWDDDEGIELIKHLSWYISATVVLADWTGSSTRFFPRV
AHPMDIKGYWQKTLIQAQNALTVFPLKAKVAPFNGINTLFPFIENPTPLQQKVLDLDISQ
QGPQLFILEDVTGAGKTEAALILAHRLIAAGKAQGLFFGLPTMATANAMYDRLVKTWLAF
YSPESRPSLVLAHSARTLMDRFNESLWSGDLVGSEEPDEQTFSQGCAAWFADSNKKALLA
EIGVGTLDQAMMAVMPFKHNNLRLLGLSNKILLADEIHACDAYMSCILEGLIERQARGGN
SVILLSATLSQQQRDKLVAAFARGTEGQQEAPFLEKDDYPWLTHVTKSDVNSHRVATRKD
VERSVSVGWLHSEQECIARIESAVSQGKCIAWIRNSVDDAIKVHRQLLARGVIPASSLSL
FHSRFAFSDRQRIETETLARFGKYCSLQRASQVIVCTQVIEQSVDVDLDEMISDLAPVDL
LIQRAGRLQRHIRDINGQLKRDGKDERSPPELLILAPVWDDSPGDEWFGSAMRNSAFVYP
DHGRIWLTQRVLREQGAIQMPHAARLLIESVYGEDVVMPEGFARSEQEQVGKYYCDRAMA
KKFVLNFRPGYAANINDYLPEKLSTRLAEESVSLWLATCIDGVVKPYATGAHAWEMSVVR
VRRSWWKKHRDEFSLLEGEAFRLWCIEQRQDPEMANVILVNDDESCGYSATEGLIGKVG
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgcgtaaatatcctttaagtttactgaaggataaaaatattgtgactttttttgatttc
tggggaaaaacccgacgcggcgagaaagacgggggcgacgactatcaccttctttgctgg
cattcgctggatgtagccgcgatgggctatttaatggttaaaagaaattgcttcgggctg
gctgattattttcgtcaattagggatttctgacaaggaacaggcggctcaatttttcgcc
tggttgctgtgctggcacgatattggaaaatttgcccgctcttttcaacaactttacctg
ccccctgaactcaagattcaggaaggtgccagaaaaaattacgaaaaaatctctcattca
acgctgggctactggttgtggaatcattatttaagtgaatgtcaggagttacttccttca
tcttcgctctctccgcgcaaacttaggcgagtgatagaaatgtggatgcccgtgacgaca
gggcatcatggtcggccccctgatcgtatggatgaattggataattttctgcctgaagac
aaagctgcagcacgagattttctccttgaaatcaaaccactgtttccgctcatagagatc
cccgcattctgggatgatgatgagggcattgaacttataaaacacctttcctggtatatc
tctgcaaccgtcgtgctcgcagactggacgggttcgtcaacgcgattttttccacgcgtc
gcacacccaatggatattaaaggttactggcagaaaactttaattcaggctcaaaacgcc
ttaaccgtctttcctctaaaagcaaaagtcgcgcctttcaacggaattaatacgctgttt
ccttttattgagaatccgacaccgttacagcaaaaggtgctggatctggatatcagccag
caaggaccgcagttatttattctggaagatgtgactggcgcaggtaaaacagaagcggcg
cttatcctggcgcacaggttgatagctgcggggaaagctcaggggctgttttttggtctg
ccaacaatggcaacggccaatgccatgtacgatcggctggtcaaaacctggcttgctttc
tattcgccagaatcccgccccagcctggtgctggcacatagtgcccgcacattaatggac
cgctttaatgaatcactctggtctggtgatttagtcgggtcagaagaaccggatgaacaa
acgttcagtcagggatgtgcggcctggtttgccgacagtaacaagaaggcgttgctggct
gaaattggcgtcggcacgctggatcaggcgatgatggcggtgatgccgttcaaacataat
aatctgcggcttctggggctgagtaacaaaatcctgctggctgatgagatccacgcctgt
gacgcttacatgtcgtgcattcttgaagggttgatcgagcggcaggcgcgtggcggaaac
agcgttattttgctttctgccacgttatctcaacagcagcgcgacaaactcgtcgctgcc
tttgcgcggggtacagagggccagcaagaagctccgttcctggaaaaggatgattacccc
tggctgacgcatgtcacgaaatccgatgtgaactcacaccgggtagcgacgcgcaaagac
gttgagcgtagcgtcagcgtgggttggcttcatagtgaacaagagtgtattgcgcgtatc
gaatcggcggtaagtcaggggaaatgcatcgcctggatccggaattctgtcgatgacgct
attaaggttcatcgtcagctgcttgcccgcggcgtcattcctgcttccagcctttcactt
tttcatagccgctttgcttttagcgatcgccagcgaattgaaacggagacactggcacgc
tttggtaaatattgtagtttacagagagcgtcgcaagtcattgtttgtacacaagtaatt
gagcaaagcgtggatgttgacctggacgaaatgatctccgacctggcccctgttgatttg
ctgattcagcgagcaggacgattacagcggcatatccgcgatattaatggtcagttaaag
cgtgacggaaaggacgagcgttccccccctgaattgctgattctggctcccgtctgggac
gactctcctggcgacgaatggtttggcagtgccatgcgtaacagtgcatttgtctatccc
gatcatgggcgaatctggctgacgcagcgtgtgctgcgtgagcaaggtgctattcagatg
ccacacgcagcccggcttcttattgaatccgtctacggtgaggacgtggtaatgccggaa
ggatttgcccgcagcgagcaggagcaagtgggcaaatattactgcgatcgcgcaatggct
aaaaagtttgtgctgaacttcaggcccggctatgccgccaatatcaacgattacctcccg
gaaaaactgtcgacacgtctggctgaggagtctgtttccctgtggctggctacctgtatt
gacggtgtggtgaagccttatgccaccggtgctcacgcatgggaaatgagcgttgtcaga
gtgcgccgaagctggtggaaaaaacatcgggatgagttttctttactggagggagaggcg
ttcaggctgtggtgcattgaacagcgacaagatccggagatggcaaacgtgattttagtc
aacgatgacgaaagttgcgggtattcggctacggaaggattgattggcaaggttggttga

DBGET integrated database retrieval system