KEGG   Escherichia coli KO11FL: EKO11_1009
Entry
EKO11_1009        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated protein, Cse1 family
  KO
K19123  CRISPR system Cascade subunit CasA
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1009
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-E factors
    EKO11_1009
SSDB
Motif
Pfam: CRISPR_Cse1
Other DBs
NCBI-ProteinID: ADX49644
Position
1068694..1070256
AA seq 520 aa
MNSFSLLTTPWLPVRFKDGTTGKLAPVDLADENVVDIAAPRADLQGAAWQFLLGLLQTSF
APKNHGRWDDIWQDGLEAEKLREALLSLEHAFQFGADSPSFMQDFEALKGDKVQVASLLP
EIPGAQTTKFNKDHFIKRGVTEHVCPHCSALALFSLQLNAPSGGKGYRTGLRGGGPMTTL
IELQEYQGNQQTPLWRKLWPNVMPQDEADLPLPKKFDDLVFPWLGPTRTSELAGAVVTHD
QVNKLQAYWGMPRRIRIDFNTTTVGNCDICGEQSDALLSLMTTKNYGANYAMWQHPLTPY
RIPLKEGGEFYSVKPQPGGLIWRDWLGLIETGKSENNTELPALVVKLFNASSLKQAKVGL
WGFGYDFDNMKARCWYEHHFPLLLKKKEGQIPKLRLAAQTASRILSLLRSALKEAWFSDP
KGARGDFSFVDIDFWNKTQHRFLRLVRQIEEGQDADELLGKWQKEIWLFARQDFDERVFT
NPYEPVDLKRVMTARKKYFTTSAEKQSAKAAREKKQEAAE
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaactcgttttcacttctgacaaccccgtggttgcctgttcgttttaaagacggaacg
acaggcaagctggcaccagtcgatctggctgatgaaaatgttgtcgatatcgctgcgccg
cgggcagatctccagggtgcggcctggcagtttttgctggggctactacaaaccagcttc
gcgcccaaaaatcacggtcgttgggatgatatctggcaagacggactggaggctgaaaag
ctacgggaagcattgctgtccttagaacacgctttccagtttggggcagattccccttca
tttatgcaggatttcgaggcgctcaagggagataaagttcaggtcgcttcgctactgcct
gagattcccggcgctcaaacaacgaagtttaataaagaccactttattaagcgtggcgtg
actgaacacgtatgccctcattgttccgcgttagctctgttctccctacagttaaatgcg
ccatcaggcggcaaaggctatcgcaccggtttgcgcggcggtgggccgatgaccactctg
attgaattacaggaatatcaaggcaatcaacaaacgcccttgtggcgcaaactgtggccc
aatgtgatgccgcaggatgaagccgacttaccgctacccaaaaaatttgacgatctggtt
ttcccctggcttggcccgacgcgaaccagcgaactggccggtgcggtggtaacccatgat
caggtcaataaactccaggcttactggggaatgccgcgccgtattcgtattgattttaat
accacgacagtcggcaactgcgatatttgcggtgaacagagcgacgcgctcctgagcctg
atgacgaccaaaaattacggtgcgaattatgccatgtggcagcatcccttaacgccttac
cgtataccacttaaagagggtggcgagttttactcggtcaaaccacaaccgggcggttta
atctggcgcgactggttaggccttatcgaaacgggtaaatcagaaaacaatacggaactt
cccgcgctggtggtgaaactctttaatgccagcagtctgaaacaggcaaaagtaggcctg
tggggatttggctatgatttcgacaacatgaaagcgcgctgttggtacgaacaccatttc
ccgctgctgctcaagaaaaaagaaggccagataccgaaactgcgtctggctgcgcaaacg
gcttcacggattctaagtctgttacgaagtgcattgaaagaagcgtggttctccgatcca
aaaggtgcacggggtgatttcagttttgtggatatcgacttctggaacaaaactcagcat
cgcttcctgaggttagtgcgccaaattgaagaaggtcaggatgcggacgaattactcggc
aaatggcaaaaggaaatttggttattcgcgcgtcaggattttgacgagcgtgtattcacc
aatccatatgagcctgttgatttgaaacgcgttatgaccgcgcgcaagaaatatttcaca
acatcggcggagaagcaaagtgctaaagccgccagggagaaaaagcaggaggctgctgaa
tga

DBGET integrated database retrieval system