KEGG   Escherichia coli KO11FL: EKO11_1010
Entry
EKO11_1010        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated protein, Cse2 family
  KO
K19046  CRISPR system Cascade subunit CasB
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1010
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-E factors
    EKO11_1010
SSDB
Motif
Pfam: CRISPR_Cse2
Other DBs
NCBI-ProteinID: ADX49645
Position
1070253..1070792
AA seq 179 aa
MSIVKEEHKATLRKWREELQAKRGNRASLRRSTTVNDVCLSEGFRSLLMQTHTLWKIEAQ
EWRFTALALVAAVSANVKAIDERQPFAAQLAAVMSKGRFTRLSAVKTPDELLRQLRRAVR
LLNGSVNLDSLAEGVFRWCQESDDLLNHHRRQQRPTEFIRIRWALEYYQAGDADNEQNQ
NT seq 540 nt   +upstreamnt  +downstreamnt
atgagtattgtaaaagaggagcacaaagccacgctgcgtaaatggcgcgaagagttgcag
gctaaacgcggcaatcgtgcaagtctgcggcgtagcacaacggttaatgatgtttgcttg
tcagaagggtttcgttctctgctgatgcagacccacactttgtggaaaattgaagcacaa
gagtggcgttttaccgcactggcgctggtcgccgcagttagcgccaatgtaaaagctatt
gatgaacggcagccttttgccgcgcagctggcggcggtaatgtcaaaggggcgttttact
cgtctgtcggcagtaaaaacaccggatgaattactgcgccagttacgccgcgcagtcaga
ttattaaacggttccgtcaatcttgactctctggcagagggggtcttccgttggtgccag
gagagcgacgacctgctcaatcatcaccgccgccagcagcggccaaccgaatttatccgt
atccgctgggcgctggaatattaccaggctggcgacgccgataacgaacaaaatcaataa

DBGET integrated database retrieval system