KEGG   Escherichia coli KO11FL: EKO11_1012
Entry
EKO11_1012        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated protein Cas5 family
  KO
K19125  CRISPR system Cascade subunit CasD
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1012
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-E factors
    EKO11_1012
SSDB
Motif
Pfam: Cas_Cas5d
Other DBs
NCBI-ProteinID: ADX49647
Position
1071870..1072616
AA seq 248 aa
MSQYLIFQLHGPMASWGVDAPGEVRHTHELPSRSALLGLLAAGVGIRRDDTERLNAFNRH
YSLVVCASRNPRWARDYHTVQMPKEVRKARYFSRREELSAPELLSAIISRRDYYTDAWWM
VAVATTPDAPYSLEQLQDGLRHPVFPLYLGRKSHPLALPLAPLLLEGNASDTLRNAYQQY
QDHFRKLKVSLPKLQDECWWEGEHDGLVASKILRRRDVPLNRQQWLFGERTVNQGPWLSK
EEPCTSQE
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagccaatatctgatttttcagcttcatgggccgatggcatcctggggcgtcgatgcc
cccggcgaagtgcgtcatacccatgaactgccttcgcgctcagcattgctggggctgctg
gctgccggggtagggatccggcgtgatgataccgaacgcttaaacgcgtttaatcgccac
tattcactggtggtttgcgccagccgtaacccgcgctgggcacgggattatcacacggtc
cagatgccaaaagaggtgcgtaaagcacgttatttcagccgtcgcgaagagttgagcgcc
cctgagcttttgagcgcgattatctcccggcgcgactactacaccgatgcctggtggatg
gtggcggtggcaacaacccccgatgcgccttacagcctcgaacagttgcaggacggttta
cgccatccggtttttccgctttatctggggcgaaaaagtcatccgctggcgttaccactt
gcgccgttactactcgaaggcaacgcgtcggataccttacgtaacgcataccaacagtat
caggatcatttccgcaaactgaaagtctcactcccaaaacttcaggatgaatgctggtgg
gaaggggaacacgacggcctggtcgcgagcaaaatattacgccgtcgggatgttccttta
aatcgtcagcagtggttgtttggggaacgcaccgtcaatcaggggccgtggctcagcaag
gaggaaccatgtacctctcaagaataa

DBGET integrated database retrieval system