KEGG   Escherichia coli KO11FL: EKO11_1014
Entry
EKO11_1014        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated protein Cas1
  KO
K15342  CRISP-associated protein Cas1
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eko03400]
    EKO11_1014
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1014
DNA repair and recombination proteins [BR:eko03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     EKO11_1014
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Universal Cas proteins
   EKO11_1014
SSDB
Motif
Pfam: Cas_Cas1 Chromo
Other DBs
NCBI-ProteinID: ADX49649
Position
1073245..1074165
AA seq 306 aa
MTFVPLSPIPLKDRTSMIFLQYGQIDVLDGAFVLINKTGIRTHIPVGSVACIMLEPGTRV
SHAAVHLAATVGTLLVWVGEAGVRVYSSGQPGGARADKLLYQAKLALTEDLRLKVVRKMY
ELRFREPPPARRSVEQLRGIEGSRVRQTYALLAKQYGVKWNGRKYDPKDWEKGDVVNRCI
SAATSCLYGISEAAVLAAGYAPAIGFIHSGKPLSFVYDIADIIKFDSVVPKAFEIAARQP
AEPDKEVRLACRDIFRSTKLTGKLIPLIEEVLAAGEIEPPQPAPDMLPPAIPEPETLGDS
GHRGRG
NT seq 921 nt   +upstreamnt  +downstreamnt
gtgacgtttgtaccactgagtccgatcccgttaaaagatcgcacctccatgatcttcctc
cagtacggtcaaatcgacgtactggacggtgctttcgtgctgatcaacaaaaccgggatc
cgcacgcacattccggtgggatcggtcgcctgcattatgctcgaaccgggaacgagagtt
tcccacgcggcggtgcatctggccgccacggtggggacgctactggtctgggtcggtgaa
gcgggtgttcgcgtctactcttccggacaacccggtggggcgcgtgctgataagttactc
taccaggcaaagctggctttaacggaagatctacgcctgaaggtggtgcgcaaaatgtat
gaattacgttttcgtgagccaccgccagctcgccgttcagtggagcagctacgtggaatt
gagggatctcgcgttcgccagacgtatgcattactggcgaaacaatatggtgtgaaatgg
aatggtcgcaaatacgatcctaaagactgggaaaaaggcgatgttgtgaatcgctgcatc
agtgctgctacatcatgtctgtacggtatatctgaagcggcagtattagccgcgggatat
gcgcccgctattgggtttatccatagtggcaaaccgctttcatttgtttatgacatagcc
gatatcattaaatttgattcggttgtaccaaaggcatttgaaatagcggcgaggcaaccc
gcagaacctgataaagaagtcagattagcctgtcgtgatattttccgtagcactaagtta
acgggcaaattaataccgttaattgaggaagtccttgccgcaggtgaaattgaaccgcca
caacctgcgccggatatgttaccgccagccatccccgaacctgaaacgttgggcgatagc
ggtcatcgaggacgcggctga

DBGET integrated database retrieval system