KEGG   Escherichia coli KO11FL: EKO11_1015
Entry
EKO11_1015        CDS       T01718                                 

Definition
(GenBank) CRISPR-associated protein Cas2
  KO
K09951  CRISPR-associated protein Cas2
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:eko02048]
    EKO11_1015
Prokaryotic defense system [BR:eko02048]
 CRISPR-Cas system
  Universal Cas proteins
   EKO11_1015
SSDB
Motif
Pfam: Cas_Cas2CT1978
Other DBs
NCBI-ProteinID: ADX49650
Position
1074165..1074458
AA seq 97 aa
MSMVVVVTENVPPRLRGRLAIWLLEVRAGVYVGDTSKRIREMIWQQITQLAGCGNVVMAW
ATNTESGFEFQTWGKNRRIPVDLDGLRLVSFLPVDNQ
NT seq 294 nt   +upstreamnt  +downstreamnt
atgagcatggtcgtggttgttacagaaaatgtcccgccgcgcttacgtggacggctcgca
atctggctactggaagtgcgtgccggtgtgtatgttggtgatacatcaaaacgtattcgg
gagatgatctggcagcaaattacccaactggcaggttgtggaaatgtggtcatggcctgg
gcgacaaatactgagtctggttttgagtttcagacctggggcaaaaacagacgtattccg
gtggatttggatgggttacgtttggtttcttttcttcctgttgataatcaataa

DBGET integrated database retrieval system