KEGG   Escherichia coli KO11FL: EKO11_1016
Entry
EKO11_1016        CDS       T01718                                 

Definition
(GenBank) peptidase M28
  KO
K09612  alkaline phosphatase isozyme conversion protein [EC:3.4.11.-]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eko01002]
    EKO11_1016
Enzymes [BR:eko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     EKO11_1016
Peptidases and inhibitors [BR:eko01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   EKO11_1016
SSDB
Motif
Pfam: Peptidase_M28 Peptidase_M42 Peptidase_M20
Other DBs
NCBI-ProteinID: ADX49651
Position
complement(1075519..1076556)
AA seq 345 aa
MFSALRHRTAALALGVCFILPVHASSPKPGDFANTQARHIATFFPGRMTGTPAEMLSADY
IRQQFQQMGYRSDIRTFNSRYIYTARDNRKSWHNVTGSTVIAAHEGKAPQQIIIMAHLDT
YAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKL
GAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHG
IAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTAAFPA
GNSWHDVRLDNQQHIDKALPGRIERRCRDVMRIMLPLVKELAKAS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgttttccgcattgcgccaccgtaccgctgccctggcgctcggcgtatgctttattctc
cccgtacacgcctcgtcacctaaacctggcgattttgctaatactcaggcacgacatatt
gctactttctttccgggacgcatgaccggaactcctgcagaaatgttatctgccgattat
attcgccaacagtttcagcaaatgggttatcgcagtgatattcggacatttaatagtcgg
tatatttataccgcccgcgataatcgtaagagctggcataacgtgacgggaagtacggtg
attgccgctcatgaaggcaaagcgccgcagcagatcatcattatggcgcatctggatact
tacgccccgctgagcgatgctgacgccgatgccaatctcggcgggctgacgttacaagga
atggatgataacgccgcaggtttaggtgtcatgctggaattggcagaacgcctgaaaaat
acgcctaccgagtatggtattcgatttgtggcgaccagcggcgaagaggaagggaaatta
ggcgctgagaatttactcaagcggatgagtgacaccgaaaagaaaaatacgctgctggtg
attaatctcgataacttaattgttggcgataaattgtatttcaacagcggtgtaaaaacc
cctgaagcagtaaggaaattaacgcgcgacagggcgctggcaattgcgcgcagtcacgga
atagccgcaacgaccaatccgggtttgaataaaaattatccgaaaggcactgggtgttgt
aatgacgcagaaatattcgacaaagcgggcattgctgtactttcggtggaagcgactaac
tggaatcttgggaataaggatggttatcagcaacgcgcaaaaacagccgcattccctgcg
ggaaatagctggcatgacgtaagactggataatcaacagcatattgataaggcacttcct
ggaagaatagaacgtcgctgccgtgacgttatgcggataatgctaccgttggtgaaggag
ctggcgaaggcgtcttga

DBGET integrated database retrieval system