KEGG   Escherichia coli KO11FL: EKO11_1017
Entry
EKO11_1017        CDS       T01718                                 

Definition
(GenBank) sulfate adenylyltransferase, small subunit
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00261  Monobactam biosynthesis
eko00450  Selenocompound metabolism
eko00920  Sulfur metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
Module
eko_M00176  Assimilatory sulfate reduction, sulfate => H2S
eko_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EKO11_1017
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_1017
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EKO11_1017
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EKO11_1017
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     EKO11_1017
SSDB
Motif
Pfam: PAPS_reduct
Other DBs
NCBI-ProteinID: ADX49652
Position
1076808..1077716
AA seq 302 aa
MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPL
LHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLK
QALNKYGFDVAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGES
IRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIK
KRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQG
YF
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatcaaaaacgacttactcacctgcggcaactggaggcggaaagcatccacattatt
cgcgaggtggcggcagaattctcaaatccggtgatgctctactctatcggtaaagattcc
agcgtcatgctgcatctggcgcgcaaggcgttttatccaggtacgctgcctttcccgttg
ctgcatgtcgataccggctggaaattccgcgagatgtatgagttccgcgatcgtactgct
aaagcctacggctgcgaactgctggtgcataaaaacccggaaggcgtggcgatggggatt
aatccattcgtgcacggcagcgcgaaacataccgatattatgaaaactgaaggcctgaaa
caggcgctgaacaaatacggttttgatgtcgccttcggtggtgcgcgccgtgacgaagag
aaatcccgcgctaaagagcgaatttactctttccgtgaccgcttccatcgctgggatccg
aaaaatcagcgcccggagctgtggcacaactacaacgggcaaattaacaaaggcgaaagc
atccgcgtcttcccgctctctaactggaccgagcaggatatctggcaatacatctggctg
gaaaatatcgacattgttccgctatatctcgctgcggaacgtccggttctggaacgcgac
ggtatgttgatgatgattgatgacaaccgtatcgacctgcaaccgggcgaagtgattaaa
aaacggatggtgcgtttccgtacgctgggctgctggccgctgaccggtgcggtggagtca
aatgcacaaacactgccggaaatcatcgaagagatgctggtttccaccaccagtgaacgt
cagggccgcgtgattgaccgcgaccaggcggggtctatggagctgaaaaaacgtcagggg
tatttttaa

DBGET integrated database retrieval system