KEGG   Escherichia coli KO11FL: EKO11_1018
Entry
EKO11_1018        CDS       T01718                                 

Definition
(GenBank) sulfate adenylyltransferase, large subunit
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00261  Monobactam biosynthesis
eko00450  Selenocompound metabolism
eko00920  Sulfur metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
Module
eko_M00176  Assimilatory sulfate reduction, sulfate => H2S
eko_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EKO11_1018
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_1018
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EKO11_1018
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    EKO11_1018
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     EKO11_1018
SSDB
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 SRPRB
Other DBs
NCBI-ProteinID: ADX49653
Position
1077718..1079145
AA seq 475 aa
MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLS
SLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQY
TRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYSEETF
TRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPWYSGPTLLEVLETVEIQRV
VDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDGDRE
EAFAGEAITLVLTDEIDISRGDLLLAADEALPAVQSASVDVVWMAEQPLSPGQSYDIKIA
GKKTRARVDGIRYQVDINNLTQREVENLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIF
IDRLSNVTVGAGMVHEPVSQATAAPSEFSAFELELNALVRRHFPHWGARDLLGDK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgaacaccgcacttgcacaacaaatcgccaatgaaggcggcgtcgaagcctggatgatt
gcgcaacaacataaaagcctgctgcgttttctgacctgtggtagcgtcgatgacggcaaa
agtactctgattggtcgtctgctgcacgatacccgccaaatctacgaagatcagctctca
tcgctgcataacgacagtaagcgtcacggcacccagggcgaaaagctggatctggctctg
ctggtggacggcctgcaagctgagcgcgaacagggcatcaccattgacgtggcctaccgc
tatttctctaccgagaagcgtaaatttattatcgccgacaccccagggcacgagcagtac
acccgcaatatggcgactggcgcatcgacatgtgaactggcgatcttactgatcgatgcc
cgtaaaggcgtgctcgatcaaacccgtcgtcacagttttatctccacactgttggggatc
aaacatctggtcgtggcgatcaacaaaatggatctggtggattacagtgaagagacgttc
acccgtattcgtgaagattatttgacctttgccgggcagctgccgggtaatctggatatc
cgctttgtgccgctctctgcactggaaggcgacaacgtggcatcgcaaagtgaaagtatg
ccgtggtacagcggtccgacactgctcgaagtgctggaaaccgtggagatccagcgagtg
gtggatgctcagccaatgcgcttcccggtgcagtacgttaatcgcccgaatctcgatttt
cgtggttacgccggaacgctggcatccggtcgcgtggaagtcgggcaacgtgtcaaagtg
ctgccctctggtgtggaatcaaacgtcgcgcggatcgtgacttttgatggtgatcgcgaa
gaagcctttgccggagaagcgatcaccctggtgctgacggatgagatcgacatcagccgt
ggcgatctgctgctggcggcagacgaagcgttaccggcggtgcagagcgcgtcggtggat
gtggtatggatggcggaacagccgctttctccagggcagagttacgacatcaaaattgcc
ggtaagaagacgcgcgcgcgtgttgatggcattcgctatcaggttgatattaataacctt
acccagcgtgaagttgaaaacctgccactgaatgggatcggcctcgtggatctcactttt
gacgagccgctggtgttagatcgttatcaacaaaatccggtgacgggtgggctgattttt
atcgatcgcctgagcaatgtgaccgtgggtgccggtatggtgcacgagccagttagccag
gcaactgctgcgccatctgaattcagtgcattcgaactggaattgaatgctctggttcgt
cgccactttccgcactggggcgcgcgcgatttgctgggggataaataa

DBGET integrated database retrieval system