KEGG   Escherichia coli KO11FL: EKO11_1019
Entry
EKO11_1019        CDS       T01718                                 

Definition
(GenBank) adenylylsulfate kinase
  KO
K00860  adenylylsulfate kinase [EC:2.7.1.25]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00920  Sulfur metabolism
eko01100  Metabolic pathways
eko01120  Microbial metabolism in diverse environments
Module
eko_M00176  Assimilatory sulfate reduction, sulfate => H2S
eko_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EKO11_1019
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_1019
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     EKO11_1019
SSDB
Motif
Pfam: APS_kinase AAA_33 AAA_18 KTI12 CbiA AAA_29 AAA_16 SRP54 ParA AAA_30 PRK MeaB Torsin AAA_17 Zeta_toxin ABC_tran AAA_22 ATP_bind_1
Other DBs
NCBI-ProteinID: ADX49654
Position
1079145..1079750
AA seq 201 aa
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTY
LLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRE
RVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQ
LVTNLVQQLLDLLRQNDIIRS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcgctgcatgacgaaaacgtcgtctggcatagccatccggtcactgtgcaacaacgc
gagctacaccacggtcatcgtggtgtagtgctgtggtttaccggcctctccgggtccggt
aaatcaacggtcgccggggcgctggaggaggcgttacataaactcggcgtcagtacgtat
ctgctggatggcgataatgttcgccacggattatgcagcgatctcggttttagcgatgcc
gatcgtaaagagaatatccgtcgcgtcggtgaagtggcgaatttgatggttgaagccgga
ctggtagtgctgaccgcatttatctcgccacaccgcgccgaacgccagatggttcgcgaa
cgcgtaggagaagggcgctttatcgaagtgtttgtcgatacgccgctggcgatttgcgaa
gcccgcgatccaaaaggcttatataagaaagcgcgtgccggtgaactgcgcaactttacg
ggaatagattccgtttacgaagcgcctgaatcggcagaaattcatctcaatggtgaacaa
ttagtaacaaatttggtacagcaattattagatctgttgagacagaacgatattatcaga
tcctga

DBGET integrated database retrieval system