KEGG   Escherichia coli KO11FL: EKO11_1020
Entry
EKO11_1020        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: DUF3561 DUF3054
Other DBs
NCBI-ProteinID: ADX49655
Position
1079800..1080123
AA seq 107 aa
MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPF
FLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG
NT seq 324 nt   +upstreamnt  +downstreamnt
atgcgtaatagccataacattacactaacaaataacgacagccttactgaggatgaagaa
accacatggtcactgcctggtgccgtggtcggttttatctcctggttatttgcgctggcg
atgccgatgttgatttatggctctaacacgctgttcttctttatctacacctggcctttc
tttctggcgctgatgcccgtcgcggtagtggtggggattgcgctgcattcattgatggac
ggaaagctacgctacagtattgttttcaccctggtgacagtaggcattatgtttggcgca
ctgtttatgtggctactgggctaa

DBGET integrated database retrieval system