KEGG   Escherichia coli KO11FL: EKO11_1021
Entry
EKO11_1021        CDS       T01718                                 

Definition
(GenBank) Septum formation initiator
  KO
K05589  cell division protein FtsB
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eko03036]
    EKO11_1021
Chromosome and associated proteins [BR:eko03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    EKO11_1021
SSDB
Motif
Pfam: DivIC
Other DBs
NCBI-ProteinID: ADX49656
Structure
PDB: 
6H9N 6H9O 5Z2W

Position
1080317..1080628
AA seq 103 aa
MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDL
NGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR
NT seq 312 nt   +upstreamnt  +downstreamnt
atgggtaaactaacgctgctgttgctggctattctggtctggctacagtattcgctgtgg
ttcggtaagaacggtatacatgactatacccgcgtcaatgatgatgtggcggcacagcaa
gctacaaacgcgaaacttaaagcgcgaaacgatcaactttttgccgaaattgacgatctc
aatggcggccaggaggcgctcgaagagcgtgcgcgtaatgaactcagcatgaccaggccg
ggcgaaactttttatcgtctggtgcctgacgcgtcgaagcgcgcacagtctgcggggcaa
aacaatcgataa

DBGET integrated database retrieval system