KEGG   Escherichia coli KO11FL: EKO11_1022
Entry
EKO11_1022        CDS       T01718                                 

Definition
(GenBank) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00900  Terpenoid backbone biosynthesis
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
Module
eko_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EKO11_1022
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     EKO11_1022
SSDB
Motif
Pfam: IspD NTP_transf_3 CTP_transf_3
Other DBs
NCBI-ProteinID: ADX49657
Structure
PDB: 

Position
1080647..1081357
AA seq 236 aa
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISP
GDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARL
LALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTR
ALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcaaccactcatttggatgtttgcgccgtggttccggcggccggatttggccgtcga
atgcaaacggaatgtcctaagcaatatctctcaatcggtaatcaaaccattcttgaacac
tcggtgcatgcgctgctggcgcatccccgggtgaaacgtgtcgtcattgccataagtcct
ggcgatagccgttttgcacaacttcctctggcgaatcatccgcaaatcaccgttgtagat
ggcggtgatgagcgtgccgattccgtgctggcaggtttgaaagccgctggcgacgcgcag
tgggtattggtgcatgacgccgctcgtccttgtctgcatcaggatgacctcgcgcgattg
ttggcgttgagcgaaaccagccgcacgggagggatcctagccgcaccagtgcgcgatacg
atgaaacgtgccgaaccgggcaaaaatgccattgctcataccgttgatcgcaacggctta
tggcacgcgctgacgccgcaatttttccctcgtgagctgttacatgactgtctgacgcgc
gctctaaatgaaggcgcgactattaccgacgaagcctcggcgctggaatattgcggattc
catcctcagttggtcgaaggccgtgcggataacattaaagtcacgcgcccggaagatttg
gcactggccgagttttacctcacccgaaccatccatcaggagaatacataa

DBGET integrated database retrieval system