KEGG   Escherichia coli KO11FL: EKO11_1023
Entry
EKO11_1023        CDS       T01718                                 

Definition
(GenBank) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00900  Terpenoid backbone biosynthesis
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
Module
eko_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EKO11_1023
Enzymes [BR:eko01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     EKO11_1023
SSDB
Motif
Pfam: YgbB
Other DBs
NCBI-ProteinID: ADX49658
Structure
PDB: 

Position
1081357..1081836
AA seq 159 aa
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcgaattggacacggttttgacgtacatgcctttggcggtgaaggcccaattatcatt
ggtggcgtacgcattccttacgaaaaaggattgctggcgcattctgatggcgacgtggcg
ctccatgcgttgaccgatgcattgcttggcgcggcggcgctgggggatatcggcaagctg
ttcccggataccgatccggcatttaaaggtgccgacagccgcgagctgctacgcgaagcc
tggcgtcgtattcaggcgaagggttataccctgggcaacgtcgatgtcactatcatcgct
caggcaccgaagatgttgccgcacattccacaaatgcgcgtatttattgccgaagatctc
ggctgccatatggatgatgttaacgtgaaagccactactacggaaaaacttggatttacc
ggacgtggggaagggattgcctgtgaagcggtggcgctactcattaaggcaacaaaatga

DBGET integrated database retrieval system