KEGG   Escherichia coli KO11FL: EKO11_1024
Entry
EKO11_1024        CDS       T01718                                 

Definition
(GenBank) tRNA pseudouridine synthase D TruD
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eko03016]
    EKO11_1024
Enzymes [BR:eko01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     EKO11_1024
Transfer RNA biogenesis [BR:eko03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    EKO11_1024
 Prokaryotic type
    EKO11_1024
SSDB
Motif
Pfam: TruD
Other DBs
NCBI-ProteinID: ADX49659
Structure
PDB: 
1SZW 1SI7 1SB7

Position
1081833..1082882
AA seq 349 aa
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVAD
ALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRK
LRSGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGALRWAQ
TNTPVRDRNKRGFWLSAARSALFNQIVAERLNKADVNQVVDGDALQLAGRGSWFVATTEE
LAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRA
MLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgattgagtttgataatctcacttacctccacggtaaaccgcaaggcaccgggctgctg
aaagccaatccggaagactttgtggtggtggaagatttgggctttgagcctgatggtgaa
ggtgagcatattctggttagaatcctcaaaaacggctgcaatacccgttttgtggcggat
gcactggcgaaattcctgaaaattcatgcccgtgaagtcagcttcgctgggcaaaaagac
aaacatgctgttacggaacagtggttatgcgctcgcgtgccaggcaaggaaatgcccgat
ctgagcgcctttcaactggaaggctgccaggtgctggagtatgcgcggcacaagcgtaag
ctgcgttcaggcgcgctgaaaggtaacgcctttaccctggttctgcgcgaagtgagcaat
cgcgatgacgttgaacaacgtctgatcgatatttgcgtaaaaggtgtaccgaactacttc
ggtgcccaacgttttgggattggcggtagcaacttgcagggcgcgctgcgctgggcgcaa
accaatactccggtgcgcgatcgtaataaacggggtttttggttgtcggcagcccgcagt
gcgttgtttaatcagattgttgctgagcgcctcaataaagcagacgttaatcaagttgtt
gacggcgatgcgctacaattagccggacgtggtagctggtttgtagcaaccaccgaagaa
ctggcggaattacagcgtcgcgtcaacgataaagagttgatgataaccgccgcattgccg
ggcagtggcgaatggggaactcagcgtgaagcgctggcattcgaacaagcagctgtcgcc
gcagaaactgaattacaagctttactggtgcgcgaaaaagttgaagccgcgcgcagagcg
atgctgctgtatccgcaacaattaagctggaattggtgggatgacgtcaccgtagagatc
cgtttctggcttccggcgggtagttttgcaaccagcgttgtcagggaacttatcaacaca
acaggtgattatgcgcatattgctgagtaa

DBGET integrated database retrieval system