KEGG   Escherichia coli KO11FL: EKO11_1025
Entry
EKO11_1025        CDS       T01718                                 

Definition
(GenBank) stationary-phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00230  Purine metabolism
eko00240  Pyrimidine metabolism
eko00760  Nicotinate and nicotinamide metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EKO11_1025
   00240 Pyrimidine metabolism
    EKO11_1025
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EKO11_1025
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     EKO11_1025
SSDB
Motif
Pfam: SurE
Other DBs
NCBI-ProteinID: ADX49660
Position
1082863..1083624
AA seq 253 aa
MRILLSNDDGVHAPGIQTLAKTLREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGSRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPDTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcgcatattgctgagtaatgatgacggggtacatgcacccggtatacaaacgctggcg
aaaaccttgcgtgagtttgctgacgttcaggtggtcgcccccgatcgtaaccgcagcggc
gcttcaaattctctgacactggaatcctccctgcgcacgtttacctttgaaaatggtgat
attgctgtgcaaatgggaaccccgaccgattgcgtctatcttggcgtgaatgctctgatg
cgtccgcgcccggacattgttgtgtccgggattaacgccgggccgaatctgggggatgat
gttatttattccggtacggtagccgccgcgatggaaggtcgccatttaggttttccggcg
cttgccgtctcgctagacgggcataaacattacgacaccgctgcggcagttacctgttct
attctgcgtgcactgtgcaaagaaccgctgcgaacagggcgtattcttaatataaatgta
ccggatttgccgctggaccaaatcaaaggaatccgcgtgactcgctgtgggagccgtcat
ccggcagatcaggtgatcccgcagcaagatcctcgtggtaatacactgtactggattggt
cctccgggggggaaatgtgacgccgggccggataccgacttcgcagcggtagatgaaggc
tatgtctccatcacgccgctgcatgtggatttaactgcgcatagcgcgcaagatgtggtt
tcagactggttaaacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system