KEGG   Escherichia coli KO11FL: EKO11_1027
Entry
EKO11_1027        CDS       T01718                                 

Definition
(GenBank) Peptidase M23
  KO
K06194  lipoprotein NlpD
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    EKO11_1027
SSDB
Motif
Pfam: Peptidase_M23 LysM Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: ADX49662
Position
1084384..1085523
AA seq 379 aa
MSAGSPKFTVRRIAALSLVSLWLAGCSDTSNPPAPVSSVNGNAPANTNSGMLITPPPKMG
TTSTAQQPQIQPVQQPQIQATQQPQIQPVQPVAQQPVQMENGRIVYNRQYGNIPKGSYSG
STYTVKKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTLQVGNASGTPITGGNAIT
QADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKMLPNNKPAATTVTAPVTVPT
ASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGASEGGNKGIDIAGSKGQAIIATADGRV
VYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLH
FEIRYKGKSVNPLRYLPQR
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgagcgcgggaagcccaaaattcaccgttcgccgcattgcggctttgtcactggtttcg
ctatggctggcaggctgttctgacacttcaaatccaccggcaccggtcagctccgttaat
ggcaatgcgcctgcaaataccaattctggtatgttgattacgccgccgccgaaaatgggg
acgacgtctacagcccagcaaccgcaaattcagccggtacagcagccacaaattcaggct
actcaacaaccgcaaatccagccagtgcagccagtagctcagcagccggtacagatggaa
aacggacgcatcgtctataaccgtcagtatgggaacattccgaaaggcagttatagcggc
agtacctataccgtgaaaaaaggcgacacacttttctatatcgcctggattactggcaac
gatttccgtgaccttgctcagcgcaacaatattcaggcaccatacgcgctgaacgttggt
cagaccttgcaggtgggtaatgcttccggtacgccaatcactggcggaaatgccattacc
caggccgacgcagcagagcaaggagttgtgatcaagcctgcacaaaattccaccgttgct
gttgcgtcgcaaccgacaattacgtattctgaatcttcgggtgaacagagtgctaacaaa
atgttgccgaacaacaagccagctgcgaccacggtcacagcgcctgtaacggtaccaaca
gcaagcacaaccgagccaactgtcagcagtacatcaaccagtacgcctatctccacctgg
cgctggccgactgagggcaaagtgatcgaaacctttggcgcttctgaggggggcaacaag
gggattgatatcgcaggcagcaaaggacaggcaattatcgcgaccgcagatggccgcgtt
gtttatgccggtaacgcgctgcgcggctacggtaatctgattatcatcaaacataatgat
gattacctgagtgcctacgcccataacgacacaatgctggtccgggaacaacaagaagtg
aaggcggggcaaaaaatagcaaccatgggtagcaccggaaccagttcaacacgcttgcat
tttgaaattcgttacaaggggaaatccgtaaacccgctgcgttatttgccgcagcgataa

DBGET integrated database retrieval system