KEGG   Escherichia coli KO11FL: EKO11_1028
Entry
EKO11_1028        CDS       T01718                                 

Definition
(GenBank) RNA polymerase, sigma 70 subunit, RpoD subfamily
  KO
K03087  RNA polymerase nonessential primary-like sigma factor
Organism
eko  Escherichia coli KO11FL
Pathway
eko02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eko00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    EKO11_1028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:eko03021]
    EKO11_1028
Transcription machinery [BR:eko03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     EKO11_1028
SSDB
Motif
Pfam: Sigma70_r3 Sigma70_r2 Sigma70_r4 Sigma70_r1_2
Other DBs
NCBI-ProteinID: ADX49663
Structure
PDB: 
5IPL 5IPM 5IPN 6FI7

Position
1085550..1086578
AA seq 342 aa
MFRQGITGRSHLMSQNTLKVHDLNEDAEFDENGVEVFDEKALVEEEPSDNDLAEEELLSQ
GATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARR
YGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLP
IHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGG
DSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATL
EDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgttccgtcaagggatcacgggtaggagccaccttatgagtcagaatacgctgaaagtt
catgatttaaatgaagatgcggaatttgatgagaacggagttgaggtttttgacgaaaag
gccttagtagaagaggaacccagtgataacgatttggccgaagaggaactgttatcgcag
ggagccacacagcgtgtgttggacgcgactcagctttaccttggtgagattggttattca
ccactgttaacggccgaagaagaagtttattttgcgcgtcgcgcactgcgtggagatgtc
gcctctcgccgccggatgatcgagagtaacttgcgtctggtggtaaaaattgcccgccgt
tatggcaatcgtggtctggcgttgctggaccttatcgaagagggcaacctggggctgatc
cgcgcggtagagaagtttgacccggaacgtggtttccgcttctcaacatacgcaacctgg
tggattcgccagacgattgaacgggcgattatgaaccaaacccgtactattcgtttgccg
attcacatcgtaaaggagctgaacgtttacctgcgaaccgcacgtgagttgtcccataag
ctggaccatgaaccaagtgcggaagagatcgcagagcaactggataagccagttgatgac
gtcagccgtatgcttcgtcttaacgagcgcattacctcggtagacaccccgctgggtggt
gattccgaaaaagcgttgctggacatcctggccgatgaaaaagagaacggtccggaagat
accacgcaagatgacgatatgaagcagagcatcgtcaaatggctgttcgagctgaacgcc
aaacagcgtgaagtgctggcacgtcgattcggtttgctggggtacgaagcggcaacactg
gaagatgtaggtcgtgaaattggcctcacccgtgaacgtgttcgccagattcaggttgaa
ggcctgcgccgtttgcgcgaaatcctgcaaacgcaggggctgaatatcgaagcgctgttc
cgcgagtaa

DBGET integrated database retrieval system