KEGG   Escherichia coli KO11FL: EKO11_1029
Entry
EKO11_1029        CDS       T01718                                 

Definition
(GenBank) transcriptional regulator, MarR family
  KO
K22489  MarR family transcriptional regulator, temperature-dependent positive regulator of motility
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eko03000]
    EKO11_1029
Transcription factors [BR:eko03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    EKO11_1029
SSDB
Motif
Pfam: MarR HTH_27 MarR_2 PadR TetR_C_28 HTH_24 HxlR Fe_dep_repress
Other DBs
NCBI-ProteinID: ADX49664
Position
complement(1086699..1087106)
AA seq 135 aa
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKA
TLAEMLARMENRGLVRREHDPADKRRRFVWLTAEGEKILAAAIPIGDSVDEEFLGRLSGE
EQELFMQLVRKMMNA
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcgttacgaaataaagcgttccatcagttacgacagctttttcagcagcacacggct
cgctggcagcacgagttacctgacctgaccaaaccacagtacgcggtgatgcgcgccatt
gctgataaacctggtatcgaacaggtggcactgatagaagcagctgtcagcaccaaagca
acgttagcagaaatgttggcaagaatggaaaatcgtggcttagtcagacgtgaacatgac
cccgctgataagcggcgacgctttgtctggttgactgccgaaggcgaaaagatacttgct
gcggcgatacccattggtgacagcgtggatgaggaatttttggggcgtttgagtggagaa
gagcaggagctgtttatgcagctggtgcgcaagatgatgaacgcatag

DBGET integrated database retrieval system