KEGG   Escherichia coli KO11FL: EKO11_1030
Entry
EKO11_1030        CDS       T01718                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00130  Ubiquinone and other terpenoid-quinone biosynthesis
eko00627  Aminobenzoate degradation
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01220  Degradation of aromatic compounds
Module
eko_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    EKO11_1030
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EKO11_1030
Enzymes [BR:eko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     EKO11_1030
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-ProteinID: ADX49665
Structure
PDB: 
1SBZ

Position
1087253..1087846
AA seq 197 aa
MKLIVGMTGATGAPLGVALLQALREMPNVETHLVMSKWAKTTIELETPYSARDVAALADF
SHNPADQAAIISSGSFRTDGMIVIPCSMKTLAGIRAGYADGLVGRAADVVLKEGRKLVLV
PREMPLSTIHLENMLALSRMGVAMVPPMPAFYNHPETVDDIVHHVVARVLDQFGLEHPHA
RRWQGLPQARNFSQENE
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaaactgatcgtcgggatgacaggggctaccggtgcgcctcttggtgtggcattactg
caagcgctgcgggagatgccgaatgtcgagactcatctggtgatgtcgaagtgggcgaaa
accaccattgaactggaaacgccttacagcgctcgcgatgttgctgccctcgcagacttc
agccataacccggcggatcaggcggcgatcatctcatccggttcttttcgtaccgacggc
atgatcgttattccgtgcagtatgaaaacgctcgccggtatccgcgctggttacgccgat
ggcctggtagggcgcgcggcggacgtcgtgctcaaagaaggccgcaaactggtgctggtg
ccgcgtgaaatgccgcttagcaccatccatctcgaaaatatgctcgcactttcacgcatg
ggcgtggcgatggtgccgccgatgcctgccttttataaccatcccgaaacggtagatgac
attgtccaccatgtggtagcccgcgtgctggatcaatttggcctcgaacatccccacgcc
aggcgctggcaaggattgccgcaggcccggaatttttctcaggagaatgaataa

DBGET integrated database retrieval system