KEGG   Escherichia coli KO11FL: EKO11_1031
Entry
EKO11_1031        CDS       T01718                                 

Definition
(GenBank) UbiD family decarboxylase
  KO
K01612  vanillate/4-hydroxybenzoate decarboxylase subunit C [EC:4.1.1.- 4.1.1.61]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00627  Aminobenzoate degradation
eko01120  Microbial metabolism in diverse environments
eko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EKO11_1031
Enzymes [BR:eko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.61  4-hydroxybenzoate decarboxylase
     EKO11_1031
    4.1.1.-  
     EKO11_1031
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-ProteinID: ADX49666
Position
1087846..1089273
AA seq 475 aa
MAFDDLRSFLQALDDHGQLLKISEEVNAEPDLAAAANATGRIGDGAPALWFDNIRGFTDA
RVAMNTIGSWQNHAISLGLPPNAPVKKQIDEFIRRWDNFPIAPERRANPAWAQNTVDGDE
INLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVGIYRMEVKGKRKLGLQPV
PMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYDQSEYEMAGALRESPYPIA
TAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTGHYSGGRNMTVVRIDKVSYRTRPI
FESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVNAMYTHGLLAIISTKKRYGGF
ARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWALSSKVNPAGDLVQLPNMSVLE
LDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVVDLPETKAWAEKLTAMLAARK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcatttgatgatttacgcagctttttacaggcgcttgatgaccacggccagttactg
aaaatcagcgaagaagtgaacgccgagccggatctggcagcagcagctaacgccaccggg
cgtatcggcgacggcgcgcccgcgctgtggtttgataatattcgcggctttaccgatgcc
cgcgtggcgatgaacaccatcggttcctggcagaaccacgcgatttccctcggcctgccg
ccaaatgccccggttaaaaagcagattgatgagtttatccgccgctgggataacttcccg
attgccccggagcgccgcgccaatccagcctgggcgcagaacaccgttgatggcgacgag
atcaacctgttcgatatcctgccgctgtttcgtttaaacgatggcgatggcggtttctat
ctcgacaaagcgtgcgtggtttcccgcgatccgctcgacccggataacttcggcaagcag
aacgtcggcatctaccgcatggaagtgaagggcaagcgtaagctcggcctgcaaccggtg
ccgatgcacgatatcgccctgcatctgcataaagcagaagagcgcggtgaagatctgccg
attgcgatcacgctcggtaacgatccgatcatcacgctgatgggggccacgccgctgaaa
tatgatcagtccgagtacgaaatggcaggcgcgctgcgtgaaagcccgtacccgatcgcc
accgccccgttgaccggttttgatgtgccgtggggttcagaagtgatcctcgaaggggtc
atcgaaagccgtaaacgcgaaatcgaagggccgttcggtgagtttaccgggcactactcc
ggcgggcgtaacatgaccgtggtgcgcatcgataaagtctcttaccgcaccaggccgatt
ttcgaatcgctgtacctcggtatgccgtggaccgaaatcgactacctgatggggccagcc
acctgcgtgccgctgtatcagcagctgaaagccgagttccctgaagtgcaggcggtaaac
gccatgtacacccatggcctgctggcgattatctccaccaaaaaacgctacggcggcttt
gcccgcgcggtgggcctgcgcgcaatgaccacgccgcatggtctgggctacgtgaagatg
gtgattatggtcgatgaagacgttgacccgttcaacctgccgcaggtgatgtgggcgctc
tcctcgaaagtgaacccggcaggggatttggtgcagttgccgaatatgtccgtgctggaa
ctcgatccaggctcaagccctgcggggatcaccgacaagctgattatcgacgccactacg
cctgtcgccccggacaaccgtggtcactacagccaaccggtggtggatttaccggaaacc
aaagcctgggctgaaaaactgaccgctatgctggctgcacgtaaataa

DBGET integrated database retrieval system