KEGG   Escherichia coli KO11FL: EKO11_1032
Entry
EKO11_1032        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
  KO
K21759  vanillate/4-hydroxybenzoate decarboxylase subunit D [EC:4.1.1.- 4.1.1.61]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00627  Aminobenzoate degradation
eko01120  Microbial metabolism in diverse environments
eko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EKO11_1032
Enzymes [BR:eko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.61  4-hydroxybenzoate decarboxylase
     EKO11_1032
    4.1.1.-  
     EKO11_1032
SSDB
Motif
Pfam: DUF1062 DUF5795 Zn_Tnp_IS1595
Other DBs
NCBI-ProteinID: ADX49667
Position
1089284..1089520
AA seq 78 aa
MICPRCADEQIEVMAKSPVKDVWTVYQCQHCLYTWRDTEPLRRTSREHYPEAFRMTQKDI
DDAPMVPSIPPLLVEGKR
NT seq 237 nt   +upstreamnt  +downstreamnt
atgatttgtccacgttgtgccgatgaacagattgaagtgatggcgaaatcgccggtgaaa
gatgtctggacggtatatcagtgccagcattgcctttatacctggcgcgataccgaaccg
ctgcgccgtaccagccgcgaacattatcccgaagcgttccgcatgacgcagaaagatatt
gatgacgcgccaatggtgccgagcatcccgccgctgctggtggaaggtaagcgttaa

DBGET integrated database retrieval system